Recombinant Yersinia pseudotuberculosis serotype O:1b Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during the production process. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
argO; YpsIP31758_0852; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
ArgO plays a crucial role in the export of arginine. It is essential for maintaining intracellular arginine levels and ensuring the proper balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis serotype O:1b and why is it significant for research?

Yersinia pseudotuberculosis serotype O:1b is a gram-negative zoonotic foodborne pathogen that belongs to the O:1b serotype within the Y. pseudotuberculosis complex. This serotype is particularly significant in research because Y. pestis, the causative agent of bubonic plague, evolved from a Y. pseudotuberculosis O:1b progenitor . While Y. pestis carries genes for the O:1b serotype, it contains inactivating mutations in four O-antigen genes, resulting in no O-antigen production . This evolutionary relationship provides a unique opportunity to study bacterial pathogen evolution and virulence mechanisms. Additionally, Y. pseudotuberculosis O:1b has been implicated in various outbreaks, including foodborne illness associated with raw milk consumption .

What is the ArgO protein and what is its function in bacterial cells?

The ArgO protein (previously known as yggA) functions as an arginine exporter in bacterial cells. Research has shown that the protein shares significant similarity with the basic amino acid exporter (LysE) found in Corynebacterium glutamicum . When ArgO is overexpressed, it leads to increased arginine efflux from bacterial cells. Its physiological function appears to be multifaceted:

  • Prevention of toxic accumulation of canavanine (a plant-derived antimetabolite) or arginine

  • Maintenance of appropriate balance between intracellular lysine and arginine concentrations

  • Potential role in stress response mechanisms

The protein is regulated by ArgP, and null mutations in argO abolish the increased arginine efflux observed in ArgP mutant strains .

How does the O-antigen structure of Y. pseudotuberculosis O:1b differ from other serotypes?

Y. pseudotuberculosis O:1b has a distinct O-antigen structure as part of its lipopolysaccharide layer. The O-antigen gene clusters in Y. pseudotuberculosis are located between the hemH and gsk genes . What makes the Y. pseudotuberculosis O-antigen system particularly interesting is that 15 of the 18 known O-antigen forms are closely related, each having one of five downstream gene modules for alternative main-chain synthesis, and one of seven upstream modules for alternative side-branch sugar synthesis .

In the O:1b serotype specifically, the genetic organization follows a pattern where the earlier a gene product functions in O-unit synthesis, the closer the gene is to the 5′ end for side-branch modules or the 3′ end for main-chain modules . This organization reflects a natural selection process that has optimized the genetic arrangement for efficient O-antigen biosynthesis.

What are the most effective expression systems for recombinant production of Y. pseudotuberculosis O:1b ArgO protein?

For recombinant production of Y. pseudotuberculosis O:1b ArgO protein, several expression systems have proven effective, each with specific advantages depending on research goals:

  • E. coli-based expression systems: Most commonly used due to their high yield and established protocols. The pET expression system under the control of T7 promoter has shown robust expression of ArgO protein. Key considerations include:

    • Use of E. coli strains with reduced proteolytic activity (BL21(DE3) or derivatives)

    • Optimization of growth temperature (typically 18-25°C after induction) to enhance proper folding

    • IPTG concentration typically between 0.1-0.5 mM for induction

  • Yeast expression systems: When post-translational modifications may be necessary, Pichia pastoris has proven effective for membrane protein expression including transporters like ArgO.

For optimal expression, consider the following methodological approach:

  • Clone the argO gene with a His6-tag for purification purposes

  • Optimize codon usage for the selected expression host

  • Include a cleavable signal sequence if secretion is desired

  • Monitor expression by Western blot analysis using anti-His antibodies

The expression system should be selected based on the intended downstream applications, whether structural studies, functional assays, or antibody production.

What purification challenges are specific to the ArgO protein, and how can they be overcome?

Purification of the ArgO protein presents several challenges typical of membrane transporters, requiring specific strategies to overcome:

  • Solubilization challenges: As a membrane protein, ArgO requires careful detergent selection to maintain native structure.

    • Methodological approach: Screen multiple detergents (DDM, LDAO, and Triton X-100) at various concentrations (typically 0.5-2%) for optimal solubilization.

    • Recommendation: Begin with a mild detergent like DDM at 1% concentration.

  • Protein stability issues: ArgO often shows reduced stability once extracted from the membrane.

    • Solution: Incorporate stabilizing agents such as glycerol (10-20%) and specific lipids (E. coli polar lipid extract at 0.1-0.2 mg/ml) in all buffers.

    • Advanced technique: Consider nanodiscs or amphipols for increased stability during structural studies.

  • Aggregation during concentration: Common issue with membrane proteins.

    • Strategy: Use spin concentrators with larger molecular weight cutoffs (50-100 kDa) and add 5% glycerol to prevent aggregation.

  • Purification protocol optimization:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

    • Wash with increasing imidazole concentrations (20 mM, 50 mM)

    • Elution with 250-300 mM imidazole

    • Size exclusion chromatography as a polishing step

Table of recommended detergents for ArgO purification:

DetergentWorking ConcentrationAdvantagesLimitations
DDM0.5-1.0%Mild, maintains functionLarger micelles
LDAO0.5-1.0%Good for crystallizationCan be harsher
Triton X-1000.5-1.0%Effective solubilizationUV interference
Digitonin0.5-1.0%Very mild, good for complex proteinsExpensive

The purity should be assessed by SDS-PAGE and Western blotting, with functional assays conducted to ensure the purified protein maintains its transport activity.

How can the arginine export activity of recombinant ArgO be measured in laboratory settings?

Measuring the arginine export activity of recombinant ArgO requires specialized techniques that quantify substrate transport across membranes. Several methodological approaches are recommended:

  • Radiolabeled substrate transport assays:

    • Preload bacterial cells or proteoliposomes with 14C or 3H-labeled arginine

    • Measure efflux rates by tracking the decrease of intracellular radioactivity over time

    • Calculate transport kinetics (Km and Vmax) under various conditions

    • This method provides the highest sensitivity for detecting transport activity

  • Fluorescence-based transport assays:

    • Utilize fluorescent arginine analogs or pH-sensitive fluorophores

    • Monitor real-time changes in fluorescence as arginine is transported

    • Advantages include continuous monitoring capability and avoidance of radioactive materials

  • Complementation assays in bacterial strains:

    • Use an E. coli strain with defective arginine export

    • Transform with recombinant ArgO expression plasmid

    • Assess growth under conditions where arginine export is beneficial (e.g., in presence of toxic arginine analogs)

    • This approach provides functional validation in a cellular context

  • Proteoliposome-based transport assays:

    • Reconstitute purified ArgO protein into liposomes

    • Create an arginine gradient across the membrane

    • Measure transport activity using either radiolabeled substrates or arginine-specific analytical methods

    • Particularly useful for determining the direct activity of the protein without cellular interference

For data analysis, consider:

  • Plotting initial transport rates versus substrate concentration

  • Fitting to Michaelis-Menten equation to determine Km and Vmax

  • Comparing wild-type versus mutant ArgO proteins to assess the impact of specific residues on transport function

These methods can be complemented with computational modeling of transport mechanisms to develop a comprehensive understanding of ArgO function.

What structural features of ArgO are critical for its function, and how can they be investigated?

The structural features of ArgO critical for its function can be investigated through multiple complementary approaches:

  • Comparative sequence analysis and evolutionary conservation:

    • Align ArgO sequences from different bacterial species, focusing on Y. pseudotuberculosis and related organisms

    • Identify highly conserved residues, which often indicate functional importance

    • Look for signature motifs typical of amino acid transporters

  • Site-directed mutagenesis:

    • Target conserved residues, particularly those in predicted transmembrane domains or substrate binding sites

    • Create alanine scanning libraries to systematically assess the role of each residue

    • Introduce specific mutations based on predicted structure-function relationships

    • Test mutants using the functional assays described in question 3.1

  • Structural biology techniques:

    • X-ray crystallography: Challenging but provides atomic-level resolution

    • Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination

    • Nuclear Magnetic Resonance (NMR): Useful for studying dynamics and substrate interactions

    • Hydrogen-deuterium exchange mass spectrometry: Provides insights into protein dynamics and conformational changes

  • Computational modeling:

    • Homology modeling based on related transporters with known structures

    • Molecular dynamics simulations to predict substrate binding and translocation pathways

    • Quantum mechanics/molecular mechanics approaches for detailed analysis of the transport mechanism

Critical structural features likely include:

Structural ElementPredicted FunctionInvestigation Method
Transmembrane domainsForm transport channelCysteine scanning, accessibility studies
Cytoplasmic loopsSubstrate recognitionChimeric protein analysis
Conserved charged residuesSubstrate binding/energy couplingSite-directed mutagenesis
Oligomerization interfacesFunctional unit formationCross-linking studies, FRET analysis

By combining these approaches, researchers can develop a comprehensive understanding of how ArgO structure relates to its function as an arginine exporter.

How is the argO gene regulated in Y. pseudotuberculosis O:1b, and how does this regulation compare to other bacteria?

The regulation of argO in Y. pseudotuberculosis O:1b involves several complex mechanisms that can be compared with those in other bacteria:

  • Transcriptional regulation:

    • In Y. pseudotuberculosis, the argO gene is regulated by environmental signals including stress conditions and nutrient availability

    • Similar to E. coli, the transcription factor ArgP likely plays a crucial role in argO regulation

    • Under arginine-rich conditions, increased expression helps maintain appropriate intracellular arginine levels

  • Comparative regulation across species:

    • E. coli: The argO gene (formerly yggA) is regulated by the ArgP transcription factor, which responds to arginine and lysine levels

    • C. glutamicum: The homologous lysE gene is regulated by the LysG transcription activator in response to elevated lysine levels

    • Y. pseudotuberculosis likely incorporates aspects of both regulatory systems, adapted to its specific ecological niche

  • Stress response regulation:

    • Environmental stressors like temperature fluctuations may influence argO expression

    • This is particularly relevant for Y. pseudotuberculosis, which can survive in diverse environments, including refrigerated conditions

    • Cold stress may trigger specific regulatory pathways affecting argO expression

  • Methodological approaches to study regulation:

    • Reporter gene assays (using promoter-lacZ or promoter-GFP fusions)

    • RNA-seq analysis under various environmental conditions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

    • Electrophoretic mobility shift assays (EMSA) to confirm protein-DNA interactions

The comparative study of argO regulation across bacterial species provides valuable insights into how this transporter has been adapted for different physiological contexts while maintaining its core function in arginine export.

What is the relationship between ArgO expression and virulence in Y. pseudotuberculosis?

The relationship between ArgO expression and virulence in Y. pseudotuberculosis represents an important area of investigation with implications for pathogenesis mechanisms:

  • Stress adaptation and virulence connection:

    • Y. pseudotuberculosis can survive and proliferate in various stressful environments, including refrigerated conditions

    • ArgO may contribute to this stress tolerance by maintaining appropriate intracellular arginine levels

    • The outbreak strain of Y. pseudotuberculosis demonstrated better growth fitness during cold stress , potentially linked to arginine metabolism and transport

  • Arginine homeostasis and pathogenicity:

    • Arginine serves as a precursor for various virulence-associated pathways in bacteria

    • Proper regulation of arginine levels via ArgO may influence:

      • Nitric oxide production and resistance

      • Biofilm formation, which was enhanced in the outbreak strain

      • Acid stress resistance in the gastrointestinal environment

  • Virulence gene expression coordination:

    • Expression of argO may be coordinated with other virulence factors

    • The high pathogenicity island (HPI) present in Y. pseudotuberculosis may interact with arginine metabolism pathways

    • The type III secretion system, essential for Y. pseudotuberculosis virulence , requires precise regulation of cellular resources, including amino acids

  • Experimental approaches to investigate this relationship:

    • Create argO knockout and overexpression strains

    • Assess virulence in infection models (cell culture and animal models)

    • Measure expression of key virulence genes in response to argO manipulation

    • Evaluate survival under conditions mimicking host environments

The study of ArgO in relation to virulence provides a potential target for understanding Y. pseudotuberculosis pathogenesis and may offer insights into novel therapeutic approaches targeting bacterial amino acid transport systems.

How can recombinant ArgO be used to develop research tools for studying Y. pseudotuberculosis pathogenesis?

Recombinant ArgO can be leveraged to develop sophisticated research tools for investigating Y. pseudotuberculosis pathogenesis:

  • Antibody development and immunological tools:

    • Generate polyclonal or monoclonal antibodies against purified recombinant ArgO

    • Applications include:

      • Immunofluorescence microscopy to visualize ArgO localization during infection

      • Western blot analysis to quantify ArgO expression under various conditions

      • Immunoprecipitation to identify protein interaction partners

  • Reporter systems for in vivo tracking:

    • Create ArgO-fluorescent protein fusions (GFP, mCherry) to monitor expression and localization

    • Develop promoter-reporter constructs to study argO regulation during infection

    • These systems can reveal temporal and spatial patterns of expression during host colonization

  • Drug discovery platforms:

    • Use purified recombinant ArgO for high-throughput screening of inhibitors

    • Develop in vitro transport assays suitable for screening compound libraries

    • Validate hits in cellular and infection models

  • Structural biology resources:

    • Purified recombinant ArgO enables structural studies via X-ray crystallography or cryo-EM

    • Structural information facilitates rational design of inhibitors or substrate analogs

    • Structure-based computational modeling can predict functional interactions

  • Methodological protocol for generating ArgO-based research tools:

    a) Cloning and expression optimization:

    • Clone argO with appropriate tags (His, FLAG, etc.)

    • Optimize expression conditions in E. coli or other systems

    • Scale up production for downstream applications

    b) Purification and quality control:

    • Implement the purification strategy outlined in question 2.2

    • Verify purity, folding, and functionality through biochemical assays

    • Prepare stable formulations for long-term storage

    c) Tool development:

    • For antibodies: Immunize animals with purified protein

    • For reporter systems: Generate fusion constructs and validate in Y. pseudotuberculosis

    • For structural studies: Optimize conditions for crystallization or cryo-EM grid preparation

These research tools can substantially advance our understanding of Y. pseudotuberculosis pathogenesis and potentially lead to new therapeutic approaches targeting amino acid transport systems.

What are the key considerations for designing experiments to study the role of ArgO in Y. pseudotuberculosis adaptation to environmental stresses?

Designing experiments to study ArgO's role in Y. pseudotuberculosis environmental stress adaptation requires careful consideration of multiple factors:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants (ΔargO) using allelic exchange

    • Create complemented strains with wild-type argO under native or inducible promoters

    • Develop point mutations in functionally important residues

    • Consider CRISPR-Cas9 approaches for precise genome editing

    • Include appropriate controls (wild-type, vector-only, point mutants)

  • Stress condition parameters:

    • Cold stress (4°C): Relevant to survival in refrigerated foods

    • Acid stress (pH 3-5): Mimics gastric passage

    • Oxidative stress (H₂O₂, paraquat): Simulates host immune response

    • Nutrient limitation: Replicates host restriction of essential nutrients

    • For each condition, establish appropriate time points (acute vs. chronic exposure)

  • Analytical methods:

    • Transcriptomics: RNA-seq to identify genes co-regulated with argO under stress

    • Proteomics: Mass spectrometry to detect changes in protein abundance and post-translational modifications

    • Metabolomics: Focus on arginine and related metabolites

    • Combine these "omics" approaches for systems biology integration

  • Phenotypic assays:

    • Growth curves under various stress conditions

    • Biofilm formation quantification

    • Stress survival assays (viable count determination)

    • Microscopy to assess morphological changes

  • Experimental design considerations:

  • Data analysis approach:

    • Statistical methods appropriate for each experiment type

    • Multiple testing correction for high-throughput data

    • Integration of results across different experimental platforms

    • Validation of key findings with alternative methods

Following these considerations will enable researchers to design robust experiments that elucidate the specific roles of ArgO in Y. pseudotuberculosis stress adaptation, particularly in contexts relevant to pathogenesis and environmental persistence.

What approaches can be used to resolve contradictory findings between in vitro and in vivo studies of ArgO function?

Resolving contradictions between in vitro and in vivo studies of ArgO function requires sophisticated approaches that bridge these different experimental contexts:

  • Physiological relevance analysis:

    • Carefully assess whether in vitro conditions accurately reflect the in vivo environment

    • Consider factors like:

      • Arginine concentration differences between laboratory media and host environments

      • pH variations in different host niches

      • Temperature fluctuations encountered during infection

      • Host-derived molecules that may interact with ArgO

    • Modify in vitro conditions to better mimic in vivo settings

  • Intermediate complexity models:

    • Develop ex vivo systems using:

      • Tissue explants that maintain cellular organization

      • Organoids derived from host tissues

      • Microfluidic "organ-on-a-chip" systems

    • These models bridge the complexity gap between simple in vitro and complex in vivo systems

  • Molecular mechanism investigation:

    • Identify post-translational modifications present in vivo but absent in vitro

    • Examine potential protein-protein interactions that occur only in host environments

    • Consider host factors that may alter ArgO activity or expression

    • Y. pseudotuberculosis activates different virulence mechanisms in vivo , which may interact with ArgO function

  • Temporal and spatial resolution enhancement:

    • Use inducible gene expression systems to control timing of ArgO expression

    • Implement cell-specific or tissue-specific promoters in animal models

    • Apply advanced imaging techniques to visualize ArgO localization in vivo

    • This approach may reveal that contradictions are due to different temporal or spatial contexts

  • Methodological framework for reconciling contradictions:

Contradiction TypeInvestigative ApproachExample Methodology
Function differencesIdentify missing cofactorsPull-down assays to find interaction partners present in vivo
Expression differencesCharacterize in vivo regulationChIP-seq to identify regulatory proteins binding the argO promoter in vivo
Localization differencesExamine trafficking mechanismsFluorescence microscopy with subcellular markers
Phenotypic impact differencesAssess compensatory mechanismsTranscriptomics to identify genes upregulated when argO is deleted
  • Integrated data analysis:

    • Develop mathematical models incorporating both in vitro and in vivo data

    • Use systems biology approaches to predict conditions where reconciliation is possible

    • Consider whether contradictions might reveal novel biological principles

    • The ability of Y. pseudotuberculosis to adapt to diverse environments suggests ArgO may have context-dependent functions

By systematically addressing these aspects, researchers can transform apparent contradictions into deeper insights about how ArgO functions across different contexts, potentially revealing nuanced roles in Y. pseudotuberculosis pathogenesis and environmental adaptation.

What emerging technologies might advance our understanding of ArgO function in Y. pseudotuberculosis pathogenesis?

Several cutting-edge technologies show promise for significantly advancing our understanding of ArgO function in Y. pseudotuberculosis pathogenesis:

  • Advanced structural biology techniques:

    • Cryo-electron tomography for visualizing ArgO in its native membrane environment

    • Micro-electron diffraction (MicroED) for determining structures from tiny crystals

    • Single-particle cryo-EM for high-resolution structure determination without crystallization

    • These approaches can reveal dynamic conformational changes during substrate transport

  • Single-cell technologies:

    • Single-cell RNA-seq to analyze ArgO expression heterogeneity during infection

    • CyTOF (mass cytometry) for high-dimensional analysis of bacterial responses

    • Single-cell metabolomics to track arginine levels in individual bacteria

    • These methods can reveal population heterogeneity that may be masked in bulk analyses

  • In situ molecular techniques:

    • MERFISH (multiplexed error-robust fluorescence in situ hybridization) for spatial transcriptomics

    • Proximity labeling (BioID, APEX) to identify protein interaction networks in living cells

    • Correlative light and electron microscopy (CLEM) to link functional data with ultrastructural localization

    • These approaches provide spatial context for ArgO function during infection

  • Genome engineering and synthetic biology:

    • CRISPR-Cas9 for precise genome editing and CRISPRi for gene expression modulation

    • Synthetic genetic circuits to control ArgO expression with temporal precision

    • Optogenetic regulation of argO for light-controlled expression in real-time

    • These tools enable unprecedented control over gene expression for mechanistic studies

  • Advanced in vivo imaging:

    • Intravital microscopy for real-time imaging in living animal models

    • Whole-body imaging with reporter bacteria expressing luminescent or fluorescent markers

    • PET imaging with radiolabeled substrates to track arginine transport in vivo

    • These techniques can visualize ArgO function in authentic infection contexts

  • Integration with multi-omics data:

    • Machine learning approaches to integrate proteomics, transcriptomics, and metabolomics data

    • Network analysis to position ArgO within the broader pathogenesis network

    • Predictive modeling to generate testable hypotheses about ArgO function

The application of these technologies could address current knowledge gaps regarding the role of ArgO in Y. pseudotuberculosis stress response and pathogenesis, potentially revealing new therapeutic targets for infection control.

How might research on ArgO contribute to novel antimicrobial strategies against Y. pseudotuberculosis?

Research on ArgO has significant potential to contribute to novel antimicrobial strategies against Y. pseudotuberculosis through multiple innovative approaches:

  • Direct inhibition of ArgO as an antimicrobial strategy:

    • Develop small molecule inhibitors targeting critical residues in the ArgO transport channel

    • Design peptidomimetics that compete with arginine for binding

    • Create substrate analogs that block transport but cannot be exported

    • Methodological approach:

      • Virtual screening against the ArgO structure

      • Fragment-based drug discovery

      • High-throughput transport assays for inhibitor screening

  • Targeting ArgO regulation pathways:

    • Disrupt transcriptional regulation of argO to compromise bacterial stress adaptation

    • Interfere with signal transduction pathways that modulate ArgO activity

    • This approach may be particularly effective since Y. pseudotuberculosis relies on stress adaptation for survival in diverse environments

  • Exploiting ArgO for bacterial sensitization:

    • Use ArgO inhibitors as adjuvants to enhance efficacy of existing antibiotics

    • Disrupt arginine homeostasis to sensitize bacteria to host immune defenses

    • Create artificial arginine gradients that compromise bacterial energy metabolism

  • ArgO-mediated delivery of antimicrobial compounds:

    • Design arginine-conjugated antimicrobial compounds that hijack ArgO for entry

    • Develop "Trojan horse" strategies using ArgO substrate recognition

    • Create pro-drugs activated by intracellular processing after ArgO-mediated import

  • Vaccine development based on ArgO research:

    • Use recombinant ArgO as a vaccine antigen

    • Identify immunogenic epitopes through structural studies

    • Create attenuated vaccine strains with modified argO expression

  • Methodological framework for antimicrobial development targeting ArgO:

Development StageKey MethodsExpected Outcomes
Target validationGene knockout studies, animal infection modelsConfirmation of ArgO as viable target
Lead identificationHigh-throughput screening, in silico dockingIdentification of initial ArgO inhibitors
Lead optimizationMedicinal chemistry, structure-activity relationshipsImproved potency and pharmacokinetics
Preclinical testingIn vitro and in vivo efficacy, toxicity assessmentCandidate selection for clinical development
  • Potential advantages of ArgO-targeted therapies:

    • Specificity for bacterial rather than host cells

    • Novel mechanism of action distinct from conventional antibiotics

    • Potential to combat Y. pseudotuberculosis in various environmental reservoirs, including cold environments where it can persist

By pursuing these approaches, ArgO research could contribute significantly to addressing the challenges posed by Y. pseudotuberculosis infections, particularly in outbreak scenarios where conventional control measures may be insufficient.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.