Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System

  • Host: Escherichia coli .

  • Form: Lyophilized powder for enhanced stability .

Role in Bacterial Physiology

  • Essential for oxidative phosphorylation, enabling ATP production via proton gradient utilization .

  • Conservation across Yersinia species highlights its critical metabolic role .

Evolutionary Context

  • Y. pseudotuberculosis O:1b is the direct progenitor of Yersinia pestis (plague pathogen) .

  • The atpF gene cluster in Y. pestis retains 98.9% nucleotide identity with Y. pseudotuberculosis O:1b but is nonfunctional due to mutations .

Research Applications

Biochemical Studies

  • Used to investigate ATP synthase assembly and proton channel mechanics .

  • Serves as a control in comparative studies with Y. pestis homologs .

Immunological Tools

  • Commercial ELISA kits utilize this recombinant protein for antibody detection (e.g., CSB-CF002358YAN) .

Vaccine Development

  • While not directly tested in vaccines, recombinant proteins like YopE-LcrV fusion (delivered via attenuated Yersinia strains) demonstrate the utility of similar antigens .

Comparative Genomic Insights

Essentiality in Yersinia

  • atpF is retained in both Y. pseudotuberculosis and Y. pestis, but Y. pestis lacks functional O-antigen biosynthesis genes .

  • TraDIS analysis identifies ATP synthase components as critical for in vitro growth, underscoring their non-redundant role .

Technical Considerations

Quality Control

  • Validated via SDS-PAGE and Western blotting with anti-His antibodies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
atpF; YpsIP31758_4180; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous F(1) catalytic core and the membrane-embedded F(0) proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, contributing to the peripheral stalk and linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit b (atpF) in bacteria?

ATP synthase subunit b (atpF) is an essential component of the peripheral stalk in bacterial F₁F₀-ATP synthase. Structurally, it forms an extremely elongated dimer with a maximum dimension of approximately 95 Å and a radius of gyration of 27 Å, consistent with an α-helical coiled-coil structure . Crystal structure analysis at 1.55 Å resolution reveals that each monomer forms an isolated α-helix with a length of about 90 Å .

Functionally, the b subunit serves as a critical part of the stator, connecting the membrane-embedded F₀ portion to the catalytic F₁ portion. In bacteria, two copies of subunit b, along with subunit a (1:2:10±1 stoichiometry with c subunits), form the F₀ complex . The first copy of subunit b occupies the same position as its yeast counterpart, while the second copy is found at a position equivalent to subunit 8 in yeast (A6L in mammals) .

The b subunit prevents rotation of the F₁ domain during ATP synthesis, anchoring it to allow the γ subunit to rotate within the α₃β₃ hexamer. Residues 62-122 are particularly important for mediating dimerization of the b subunit , which is essential for its stator function.

How can recombinant ATP synthase subunit b be expressed and purified for structural studies?

Recombinant expression and purification of ATP synthase subunit b requires careful optimization due to its hydrophobic transmembrane region and tendency to form inclusion bodies. A methodological approach involves:

  • Vector Selection and Construct Design:

    • Clone the atpF gene into an expression vector (e.g., pET system) with an N-terminal His₆-tag

    • Consider expressing only the soluble portion (residues 34-156) to improve solubility

    • Include appropriate restriction sites (e.g., NdeI and XhoI) for cloning verification

  • Expression System:

    • Transform into E. coli strain BL21(DE3) or similar expression hosts

    • Culture in rich media (ZYP-5052 autoinduction medium) supplemented with appropriate antibiotics

    • Induce expression at lower temperatures (16-18°C) to reduce inclusion body formation

  • Purification Protocol:

    • Lyse cells using multiple passes through a microfluidizer (18,000 lb/in²)

    • Clarify lysate by ultracentrifugation (150,000 × g for 45 min)

    • Perform immobilized metal affinity chromatography using Ni-NTA agarose with step-gradient elution (0-250 mM imidazole)

    • Further purify using ion-exchange chromatography (ResQ column) with linear gradient elution from 150-500 mM NaCl

    • Confirm purity by SDS-PAGE and concentrate using 100 kDa-cutoff centricons

This approach yields highly purified protein suitable for structural and functional studies, with typical yields of 2-5 mg/L of culture.

What is the basic mechanism by which bacterial ATP synthase functions?

Bacterial ATP synthase operates through a rotary mechanism coupling proton translocation to ATP synthesis. The core mechanism involves:

  • Proton Gradient Formation:

    • The electron transport chain pumps protons across the bacterial membrane, creating a proton motive force

    • This establishes a proton gradient with higher concentration in the periplasmic space than the cytoplasm

  • Proton Flow and Rotation:

    • Protons flow through the a subunit and the c-ring interface down their concentration gradient

    • Each proton binds to a conserved glutamate residue on a c subunit at the a-c interface

    • After rotation, the proton is released to the cytoplasmic side

    • This proton flow drives rotation of the c-ring and attached central stalk (γε subunits)

  • ATP Synthesis:

    • The rotating γ subunit causes conformational changes in the catalytic β subunits

    • Each β subunit cycles through three states: open (βE), loose (βTP), and tight (βDP)

    • In the tight conformation, ADP and Pi are brought together to form ATP

    • For each 360° rotation, three ATP molecules are synthesized

In bacteria, approximately 3-4 protons are required to synthesize each ATP molecule, and the enzyme can produce more than 100 ATP molecules per second under optimal conditions .

How does the structure of Y. pseudotuberculosis atpF influence ATP synthase assembly and function?

The ATP synthase subunit b (atpF) in Y. pseudotuberculosis plays a critical role in both assembly and function through its unique structural properties:

  • Dimerization Domain:

    • The b subunit forms a dimer through residues 62-122, creating an extremely elongated structure (maximum dimension ~95 Å)

    • This dimerization is crucial for forming the peripheral stalk that prevents rotation of the F₁ portion during catalysis

    • Binding studies reveal a dissociation constant of 1.8 μM for the dimerized b subunit , indicating moderate stability of this interaction

  • F₁ Binding Interface:

    • The C-terminal water-soluble portion of subunit b displays significant conformational variability between rotational states

    • Fluorescence correlation spectroscopy and steady-state FRET measurements indicate a remarkably strong binding between the b subunit and F₁, with a dissociation constant of 0.2-0.6 nM

    • This corresponds to a Gibbs free energy of binding (ΔG°) of -52 to -55 kJ mol⁻¹

  • Membrane Anchoring:

    • The N-terminal transmembrane helix (bH1) interacts with the a subunit, helping maintain the integrity of the proton pathway

    • Both copies of subunit b (b and b') occupy specific positions relative to the membrane sector

The binding energy of the b subunit appears to be too low for models in which the free energy for ATP synthesis is accumulated in elastic strain between rotor and stator subunits and then transduced to the catalytic site in one step. This suggests that energy transduction in Y. pseudotuberculosis ATP synthase likely occurs in at least two steps , providing a mechanism to prevent slippage during rotational catalysis.

What methodological approaches can be used to study the role of atpF in ATP synthase assembly?

Studying the role of atpF in ATP synthase assembly requires sophisticated methodological approaches:

  • Site-Directed Mutagenesis:

    • Generate point mutations in key residues using PCR-based mutagenesis

    • Create truncated variants (ΔαCTD, Δγ166-179) to test domain functions

    • Verify mutations by DNA sequencing before expression

  • Protein-Protein Interaction Analysis:

    • Fluorescence Correlation Spectroscopy:

      • Label mutant bT62C with fluorophores like Cy3 or Alexa488

      • Measure translational diffusion times of labeled b subunit alone and mixed with unlabeled F₁

      • Calculate dissociation constants from diffusion time changes

    • Fluorescence Resonance Energy Transfer (FRET):

      • Label F₁-γT106C with donor fluorophore (e.g., Alexa488)

      • Label b subunit with acceptor fluorophore

      • Measure fluorescence decrease upon binding to determine interaction strength

  • Functional Reconstitution:

    • Reconstitute purified ATP synthase or component subunits into liposomes

    • Measure both ATP synthesis and proton pump activities

    • Compare wild-type enzyme with atpF variants to determine functional effects

  • Molecular Dynamics Simulations:

    • Perform atomistic simulations of the peripheral stalk

    • Model conformational changes during the catalytic cycle

    • Integrate with experimental data from FRET and structural studies

Using these approaches, researchers have demonstrated that mutations in peripheral stalk components can significantly affect both ATP synthesis and hydrolysis activities, highlighting the critical role of atpF in proper assembly and function of the ATP synthase complex.

How does atpF contribute to the auto-inhibition mechanism observed in some bacterial ATP synthases?

The auto-inhibition mechanism in bacterial ATP synthases involves a complex interplay between multiple subunits, including the peripheral stalk containing atpF (subunit b). Research on mycobacterial ATP synthase provides valuable insights applicable to Y. pseudotuberculosis:

  • Fail-Safe Mechanism:

    • The auto-inhibitory mechanism involves not only the C-terminal domain (CTD) of the α subunit and a loop in the γ subunit, but also the b' subunit in the peripheral stalk

    • The b' subunit enhances engagement of the α-CTD with the γ-loop in state S1, forming a "fail-safe" device that prevents futile ATP hydrolysis

    • This mechanism is particularly important during energy-limited conditions when preserving ATP is crucial for bacterial survival

  • Structural Evidence:

    • Cryo-EM structures of mycobacterial ATP synthase reveal that the peripheral stalk (specifically the b' subunit) forms critical interactions that enhance the auto-inhibitory state

    • The peripheral stalk shows conformational flexibility, adopting different positions in various rotational states to facilitate this regulation

  • Functional Consequences:

    • ATP hydrolysis assays with reconstituted ATP synthase variants demonstrate that disruption of peripheral stalk components can abolish auto-inhibition

    • In Y. pseudotuberculosis, this mechanism likely ensures that ATP hydrolysis is prevented while allowing ATP synthesis to proceed normally

This auto-inhibition mechanism represents a potential target for antimicrobial development, as compounds that lock the peripheral stalk in the inhibitory conformation could prevent ATP synthesis in pathogenic bacteria without affecting human ATP synthases, which have different regulatory mechanisms .

What role might atpF play in bacterial virulence and pathogenesis?

The ATP synthase subunit b (atpF) may contribute to Y. pseudotuberculosis virulence through several mechanisms:

  • Bioenergetic Support for Virulence:

    • ATP synthase provides the energy required for various virulence processes

    • Type III secretion systems (T3SS), essential for Y. pseudotuberculosis pathogenesis, require ATP for assembly and function

    • The ATPase activity of YscN, a component of the Yop secretion machinery, depends on Walker boxes A and B similar to those in F₁F₀-ATPase

  • Metabolic Adaptation:

    • Proper function of atpF is crucial for ATP synthesis during infection

    • Y. pseudotuberculosis must adapt to different metabolic environments in the host

    • Mutations affecting ATP synthase assembly or function could impair survival under energy-limited conditions

  • Potential Immunological Role:

    • ATP released by bacteria can function as a danger signal for the immune system

    • Disruption of ATP synthase components could alter ATP release patterns

    • ATP synthase subunits have been identified as immunogenic in other bacterial pathogens

  • Experimental Evidence:

    • Studies in Mycobacterium tuberculosis show that ATP synthase is essential for growth and virulence

    • The unique features of bacterial ATP synthase, including peripheral stalk components, provide potential targets for antimicrobial development

    • ATP synthase subunits have been identified as serological markers in some bacterial infections

While direct evidence for atpF's role in Y. pseudotuberculosis virulence is limited, the critical function of ATP synthase in bacterial metabolism and the unique structural features of bacterial atpF suggest it could be an important factor in pathogenesis and a potential target for therapeutic intervention.

How can single-molecule techniques be applied to study the rotational dynamics of ATP synthase with modified atpF?

Single-molecule techniques offer powerful approaches to study how modifications to atpF affect the rotational dynamics of ATP synthase:

  • Single-Molecule Rotation Assays:

    • Experimental Setup:

      • Immobilize the F₁ domain on a glass surface through His-tags or biotin-streptavidin linkages

      • Attach fluorescent markers (quantum dots, gold nanoparticles) to the γ subunit

      • Observe rotation using total internal reflection fluorescence microscopy (TIRFM)

    • Analysis Approaches:

      • Measure angular velocity during power strokes after ATP binding

      • Determine dwell times at specific angular positions

      • Identify substeps (83°, 91°, 101°, and 120°) within the complete 120° rotational step

  • Effects of Modified atpF:

    • Modifications to atpF can alter the rigidity of the peripheral stalk

    • Introduction of disulfide bonds can "stiffen" specific domains to test elasticity contributions

    • Changes in angular velocity and dwell times can reveal how atpF influences energy transmission during rotational catalysis

  • Key Findings from Related Studies:

    • Single-molecule rotation assays have shown that mutations in ATP synthase components can decrease the angular velocity of the power stroke after ATP binding

    • ATP hydrolysis-driven rotation proceeds through discrete substeps associated with specific conformational changes

    • The peripheral stalk (including atpF) influences rotational dynamics by providing an elastic coupling between F₁ and F₀

  • Advanced Analysis Methods:

    • High-speed imaging (>1000 frames/second) to capture transient substeps

    • Application of external force using magnetic tweezers to probe mechanical properties

    • Correlation of rotational data with structural transitions identified in cryo-EM studies

By applying these single-molecule techniques to Y. pseudotuberculosis ATP synthase with modified atpF, researchers can gain insights into how the peripheral stalk influences the mechano-chemical coupling essential for ATP synthesis and hydrolysis.

What are the optimal conditions for expressing recombinant Y. pseudotuberculosis atpF in E. coli?

Optimal expression of recombinant Y. pseudotuberculosis atpF in E. coli requires careful optimization of multiple parameters:

  • Expression System:

    • Vector Selection:

      • pET-based vectors with T7 promoter system provide high expression levels

      • Include N-terminal His₆-tag for purification and detection

      • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Host Strain:

      • E. coli BL21(DE3) or derivatives optimized for membrane protein expression

      • C41(DE3) and C43(DE3) strains better tolerate toxic membrane proteins

      • Consider strains with rare codon supplementation (Rosetta™) if Y. pseudotuberculosis codon usage differs significantly

  • Culture Conditions:

    • Media Optimization:

      • Autoinduction medium (ZYP-5052) provides high cell density without monitoring OD₆₀₀

      • Supplementation with 50 μg/mL of appropriate antibiotics (kanamycin, ampicillin)

      • Addition of 0.2% glucose to reduce basal expression before induction

    • Growth Parameters:

      • Initial growth at 37°C until OD₆₀₀ reaches 0.6-0.7

      • Shift to 18-20°C before induction to enhance proper folding

      • Extended expression time (16-24h) at lower temperature

  • Induction Strategy:

    • For IPTG-inducible systems, use lower concentrations (0.1-0.5 mM)

    • For autoinduction, culture for 24-72h depending on temperature

    • Consider addition of membrane-stabilizing agents (glycerol 5-10%)

  • Cell Harvest and Storage:

    • Harvest cells by centrifugation at 4°C, 3,600 × g for 20 min

    • Wash cell pellets with buffer containing protease inhibitors

    • Flash-freeze in liquid nitrogen and store at -80°C

These optimized conditions typically yield 2-5 mg of recombinant protein per liter of culture, with higher yields possible through further optimization of strain-specific parameters.

How can ATP synthase activity be measured in reconstituted proteoliposomes?

Measuring ATP synthase activity in reconstituted proteoliposomes involves both ATP synthesis and ATP hydrolysis assays:

  • Reconstitution Protocol:

    • Liposome Preparation:

      • Prepare liposomes from E. coli polar lipids or synthetic mixtures (DOPC/DOPE/DOPG)

      • Extrude through polycarbonate filters (400 nm, then 200 nm) to generate uniform vesicles

      • Destabilize with detergent (Triton X-100 or C₁₂E₈) at onset of solubilization

    • Protein Incorporation:

      • Add purified ATP synthase at lipid-to-protein ratio of 20:1 to 50:1

      • Remove detergent using Bio-Beads SM-2 or dialysis

      • Separate unincorporated protein by sucrose gradient ultracentrifugation

  • ATP Synthesis Assay:

    • Establishing Proton Gradient:

      • Acidify internal lumen to pH 5.5 during reconstitution

      • Rapidly change external pH to 8.0 to establish ΔpH

      • Add valinomycin with K⁺ gradient to establish Δψ

    • Measurement of ATP Formation:

      • Add ADP (10 μM) and Pi (250 μM) to initiate synthesis

      • Incubate for 30 minutes at room temperature

      • Quantify ATP using luciferase-based detection (CellTiter-Glo)

      • Calculate ATP synthesis rates (nmol ATP/min/mg protein)

  • ATP Hydrolysis Assay:

    • Continuous Assay:

      • Use enzyme-coupled system with pyruvate kinase and lactate dehydrogenase

      • Monitor NADH oxidation at 340 nm

      • Calculate hydrolysis rates from linear decrease in absorbance

    • Controls and Inhibitors:

      • Include oligomycin to determine ATP synthase-specific activity

      • Use FCCP to collapse proton gradient and confirm ATP synthesis is pmf-dependent

      • Add N,N'-dicyclohexylcarbodiimide (DCCD) to inhibit proton translocation

  • Data Analysis:

    • Calculate ATP synthesis/hydrolysis rates normalized to protein content

    • Compare activities of wild-type and mutant enzymes

    • Determine effects of inhibitors on enzymatic activities

This comprehensive approach allows quantitative assessment of both ATP synthesis and hydrolysis activities of reconstituted Y. pseudotuberculosis ATP synthase under controlled conditions.

What analytical techniques are most effective for studying atpF dimerization and peripheral stalk assembly?

Multiple analytical techniques can effectively characterize atpF dimerization and peripheral stalk assembly:

  • Biophysical Techniques:

    • Analytical Ultracentrifugation:

      • Sedimentation velocity experiments to determine oligomeric state

      • Sedimentation equilibrium to calculate dissociation constants

      • Has revealed a dissociation constant of 1.8 μM for truncated b subunit dimerization

    • Small-Angle X-ray Scattering (SAXS):

      • Determines solution shape and dimensions

      • Has shown that the b subunit dimer is extremely elongated (maximum dimension ~95 Å, radius of gyration ~27 Å)

      • Can detect conformational changes under different conditions

  • Spectroscopic Methods:

    • Fluorescence Correlation Spectroscopy:

      • Labels mutant bT62C with fluorophores

      • Measures translational diffusion times

      • Has determined a dissociation constant of 0.2 nM for the F₁b₂ complex

    • Fluorescence Resonance Energy Transfer (FRET):

      • Labels F₁-γT106C with Alexa488 (donor)

      • Monitors fluorescence decrease upon binding

      • Has yielded dissociation constants of 0.6-14 nM depending on binding model

  • Structural Biology Approaches:

    • Cryo-Electron Microscopy:

      • Visualizes intact ATP synthase in different rotational states

      • Resolves peripheral stalk architecture at near-atomic resolution

      • Has identified "fail-safe" mechanisms involving b' subunit and α-CTD interaction

    • Cross-Linking Mass Spectrometry:

      • Uses bifunctional cross-linkers to capture protein-protein interactions

      • Identifies interacting domains through MS/MS analysis

      • Can map interfaces between atpF and other subunits

  • Computational Methods:

    • Molecular Dynamics Simulations:

      • Models conformational dynamics of the peripheral stalk

      • Predicts effects of mutations on stability and function

      • Integrates with experimental structural data

These complementary techniques provide comprehensive characterization of atpF dimerization and peripheral stalk assembly, revealing both structural details and binding energetics critical for understanding ATP synthase function.

How can Y. pseudotuberculosis ATP synthase research contribute to antimicrobial development?

Y. pseudotuberculosis ATP synthase research offers several promising avenues for antimicrobial development:

  • Targeting Unique Structural Features:

    • The peripheral stalk components (including atpF) have unique structural elements compared to human ATP synthase

    • The "hook and catch" and "fail-safe" mechanisms present in bacterial ATP synthases represent specific drug targets

    • Small molecules designed to lock these mechanisms in place could inhibit ATP synthesis in bacteria without affecting human enzymes

  • Rational Drug Design Approaches:

    • Structure-Based Design:

      • Cryo-EM structures of bacterial ATP synthases provide templates for virtual screening

      • Molecular docking can identify compounds that bind at subunit interfaces

      • Fragment-based approaches can target specific pockets in the peripheral stalk

    • Peptide Inhibitors:

      • Peptides mimicking the C-terminal domain of subunit α could enhance auto-inhibition

      • Stapled peptides could improve stability and cell penetration

      • Peptide-small molecule conjugates could provide increased specificity

  • Targeting Assembly Pathways:

    • Inhibitors that prevent proper dimerization of atpF could disrupt ATP synthase assembly

    • Small molecules that interfere with peripheral stalk attachment to F₁ or F₀ domains

    • Compounds that alter the binding energy between components could destabilize the complex

  • Experimental Validation Strategies:

    • Primary Screening:

      • ATP synthesis/hydrolysis assays in membrane vesicles

      • Growth inhibition assays under conditions requiring oxidative phosphorylation

      • Fluorescence-based binding assays for target engagement

    • Secondary Validation:

      • Structural studies of inhibitor-bound complexes

      • Resistant mutant analysis to confirm target specificity

      • In vivo efficacy in animal infection models

The unique regulatory features of bacterial ATP synthases, including the peripheral stalk containing atpF, provide promising targets for developing new antibiotics with limited cross-reactivity with human ATP synthases .

What are the current challenges in studying cooperativity among ATP synthase subunits?

Studying cooperativity among ATP synthase subunits presents several methodological and conceptual challenges:

  • Technical Limitations:

    • Complex Assembly Control:

      • Difficulty in generating ATP synthase with specific subunit combinations

      • Challenge of expressing complete enzyme complexes with defined mutations

      • Recent advances using genetically fused single-chain c-rings offer promise

    • Measuring Rotation and Catalysis Simultaneously:

      • Synchronizing structural observations with catalytic events

      • Limited temporal resolution of structural methods versus rapid catalysis

      • Need for specialized single-molecule approaches with high time resolution

  • Data Interpretation Challenges:

    • Distinguishing Direct vs. Indirect Effects:

      • Mutations in one subunit may cause long-range structural changes

      • Differentiating between local effects and global conformational alterations

      • Need for complementary structural and functional analyses

    • Quantifying Cooperative Interactions:

      • Mathematical modeling of multi-site cooperativity

      • Accounting for different time scales of conformational changes

      • Integrating data from multiple experimental approaches

  • Recent Advances and Remaining Questions:

    • Recent studies with Bacillus PS3 ATP synthase demonstrated that c-subunits cooperate in rotation-coupled ATP synthesis

    • Activity progressively decreases as mutations in c-subunits are separated, indicating cooperation

    • Molecular simulations revealed that prolonged proton uptake in mutated c-subunits is shared between two c-subunits

    • Similar cooperative mechanisms likely exist between peripheral stalk components and catalytic subunits

  • Future Approaches:

    • Development of ATP synthase with orthogonally labeled subunits for multicolor FRET

    • Time-resolved cryo-EM to capture transient states during catalysis

    • Integration of structural data with computationally predicted energy landscapes

Understanding cooperativity among ATP synthase subunits remains challenging but essential for developing a complete mechanistic picture of this complex molecular machine and identifying novel therapeutic targets.

How does evolutionary conservation of atpF inform functional studies in Y. pseudotuberculosis?

Evolutionary conservation analysis of atpF provides valuable insights for functional studies in Y. pseudotuberculosis:

Evolutionary analysis reveals that while atpF sequence has diverged, its core structural and functional properties remain conserved across species. This conservation pattern guides rational design of experiments to identify both universally important features and species-specific adaptations in Y. pseudotuberculosis ATP synthase.

What are common pitfalls in recombinant ATP synthase subunit expression and how can they be overcome?

Recombinant expression of ATP synthase subunits presents several challenges that can be addressed through specific methodological approaches:

  • Protein Solubility Issues:

    • Problem: Formation of inclusion bodies due to hydrophobic regions

    • Solutions:

      • Express only the soluble portion (e.g., residues 34-156 of subunit b)

      • Use fusion partners (MBP, SUMO, thioredoxin) to enhance solubility

      • Lower induction temperature to 16-18°C and extend expression time

      • Include detergents or membrane-mimetic systems for full-length proteins

  • Protein Stability Challenges:

    • Problem: Degradation during expression or purification

    • Solutions:

      • Add protease inhibitor cocktail during all steps

      • Include 10% glycerol in all buffers to stabilize protein structure

      • Optimize buffer conditions (pH, salt concentration)

      • Perform all purification steps at 4°C

  • Low Expression Yields:

    • Problem: Poor expression levels of membrane proteins

    • Solutions:

      • Screen multiple expression strains (BL21, C41/C43, Rosetta)

      • Test different media formulations (LB, TB, autoinduction)

      • Optimize codon usage for E. coli expression

      • Consider cell-free expression systems for toxic proteins

  • Purification Difficulties:

    • Problem: Co-purification of contaminants or aggregates

    • Solutions:

      • Implement two-step purification (IMAC followed by ion-exchange)

      • Use size exclusion chromatography as a final polishing step

      • For atpF dimerization domains, use step-gradient salt elution to resolve peaks

      • Verify protein quality by dynamic light scattering before functional assays

These methodological considerations have been successfully applied to obtain pure, functional ATP synthase components from various bacterial species and can be adapted for Y. pseudotuberculosis atpF expression and purification.

How can researchers troubleshoot ATP synthesis assays that show low activity?

When ATP synthesis assays show low activity with recombinant or reconstituted ATP synthase, several systematic troubleshooting approaches can identify and resolve the issues:

  • Enzyme Integrity Issues:

    • Problem: Incomplete or damaged ATP synthase complex

    • Diagnostic Tests:

      • SDS-PAGE to verify presence of all subunits

      • Native-PAGE to assess complex integrity

      • Western blot with subunit-specific antibodies

    • Solutions:

      • Optimize purification to maintain intact complex

      • Adjust detergent type and concentration

      • Include stabilizing agents (glycerol, sucrose)

  • Proton Gradient Problems:

    • Problem: Insufficient or rapidly dissipating proton motive force

    • Diagnostic Tests:

      • Measure pH changes with pH-sensitive dyes

      • Use membrane potential dyes (DiSC3(5)) to verify Δψ

      • Test proton leakage with passive proton permeability assays

    • Solutions:

      • Increase buffer capacity for more stable pH gradients

      • Use freshly prepared liposomes with optimal lipid composition

      • Verify valinomycin activity with K⁺ efflux assays

  • Assay Component Issues:

    • Problem: Suboptimal concentrations or quality of assay components

    • Diagnostic Tests:

      • Titrate ADP and Pi concentrations (typical optimal: 10 μM ADP, 250 μM Pi)

      • Test luciferase reagent with ATP standards

      • Verify absence of contaminating ATPase activity

    • Solutions:

      • Use fresh, high-purity nucleotides and Pi

      • Include Mg²⁺ at appropriate concentrations (2-5 mM)

      • Optimize incubation time and temperature

  • Reconstitution Issues:

    • Problem: Poor protein incorporation or orientation in liposomes

    • Diagnostic Tests:

      • Fluorescence quenching to determine orientation

      • Protease protection assays to verify membrane insertion

      • Freeze-fracture electron microscopy to visualize incorporation

    • Solutions:

      • Optimize lipid-to-protein ratio (typically 20:1 to 50:1)

      • Try different reconstitution methods (detergent dialysis vs. Bio-Beads)

      • Include lipids matching bacterial membrane composition

By systematically addressing these potential issues, researchers can optimize ATP synthesis assays for Y. pseudotuberculosis ATP synthase and obtain reliable, reproducible activity measurements.

What are the most effective approaches for studying the interaction between atpF and other ATP synthase subunits?

Studying interactions between atpF and other ATP synthase subunits requires complementary biophysical and biochemical approaches:

  • In Vitro Binding Assays:

    • Pull-Down Assays:

      • Immobilize His-tagged atpF on Ni-NTA resin

      • Incubate with potential interaction partners

      • Analyze bound proteins by SDS-PAGE and mass spectrometry

    • Surface Plasmon Resonance (SPR):

      • Immobilize atpF on sensor chip

      • Flow other subunits over the surface

      • Determine association/dissociation rates and binding affinities

      • Can detect interactions with K<sub>d</sub> values from nM to μM range

  • Structural Methods:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

      • Maps interaction interfaces through differential solvent accessibility

      • Identifies regions protected upon complex formation

      • Requires minimal sample amounts and can detect transient interactions

    • Cross-Linking Mass Spectrometry:

      • Uses chemical cross-linkers of defined length

      • Identifies residues in close proximity between subunits

      • Provides distance constraints for modeling interfaces

  • Fluorescence-Based Methods:

    • Förster Resonance Energy Transfer (FRET):

      • Label atpF and potential partners with fluorophore pairs

      • Measure energy transfer as indicator of proximity

      • Can be performed in solution or with reconstituted complexes

      • Has revealed strong binding between b subunit and F₁ (K<sub>d</sub> = 0.2-0.6 nM)

    • Fluorescence Anisotropy:

      • Label smaller subunit with fluorophore

      • Measure changes in rotational diffusion upon binding

      • Determine binding constants in solution

  • Genetic Approaches:

    • Bacterial Two-Hybrid System:

      • Fuse atpF and potential partners to complementary fragments of adenylate cyclase

      • Interaction reconstitutes enzyme activity

      • Screen for interactions in living bacterial cells

    • Suppressor Mutation Analysis:

      • Introduce mutations in atpF that disrupt function

      • Screen for compensatory mutations in other subunits

      • Identify functionally important interaction sites

These complementary approaches provide a comprehensive characterization of atpF interactions with other ATP synthase subunits, revealing both structural determinants and binding energetics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.