Recombinant Yersinia pseudotuberculosis serotype O:1b Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Virulence Factors and Mechanisms

Yersinia species, including Y. pseudotuberculosis, harbor a 70-kb virulence plasmid that enables them to survive and multiply within the host's lymphoid system . This plasmid encodes for Yop (Yersinia outer proteins) effectors, which are crucial for the bacteria's pathogenicity. Several Yops, such as YopE and YopH, act in concert to inhibit phagocytosis by macrophages, allowing Yersinia to proliferate in Peyer’s patches as extracellular microcolonies .

Yersinia can resist specific uptake via Fc receptors, and pretreatment with wild-type bacteria can block a general phagocytic mechanism . Furthermore, Yersinia inhibits the release of tumor necrosis factor-alpha (TNF-α) by macrophages, requiring a functional type III secretion machinery, a Yop translocation apparatus, and the effector YopP (Y. enterocolitica)/YopJ (Y. pseudotuberculosis) .

O-Specific Polysaccharide (OPS) Structure

The O-specific polysaccharide (OPS) is a crucial component of the lipopolysaccharide (LPS) in Gram-negative bacteria like Yersinia . The OPS of Y. pseudotuberculosis serotype O:15, for example, has a pentasaccharide repeating unit with a tetrameric backbone identical to that of O:5a and a branching paratofuranose residue identical to that of O:1b .

Table 1: 1H and 13C Chemical Shifts (δ) of the OPS from Y. pseudotuberculosis O:15

ResidueH-/C-1H-/C-2H-/C-3H-/C-4H-/C-5H-/C-6
A !3)-α-D-GalpNAc5.294.403.884.024.203.78–3.73
B α-D-Asc
C α-L-Fucp
D →2)-α-D-Manp

The O:15 structure contains a tetrameric backbone identical to that of O:5a, while the branching paratofuranose residue is identical to that of O:1b. The enzymes necessary for the biosynthesis of the O:15 repeating unit are encoded by a gene cluster, which also handles translocation and polymerization into OPS .

Role of Metallo-Oligopeptidase OpdA

Oligopeptidases, such as OpdA in Y. pseudotuberculosis, are involved in the degradation of short peptides and leader peptides released during protein secretion . OpdA is required for bacterial virulence, and its enzymatic activity is dependent on divalent cations .

  • Zn2+ stimulates activity at low concentrations but inhibits it at higher concentrations.

  • Co2+, Ca2+, and Mn2+ stimulate activity at all concentrations tested.

  • Mg2+ has no effect on enzyme activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
aas; YpsIP31758_0975; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
aas
Target Protein Sequence
MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKAARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate. This process requires ATP and magnesium ions. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.