Recombinant Yersinia pseudotuberculosis serotype O:1b Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Characteristics of Yersinia pseudotuberculosis serotype O:1b

Yersinia pseudotuberculosis is a Gram-negative bacterium that causes a variety of clinical manifestations . Y. pseudotuberculosis serotype O:1b is closely related to Y. pestis and carries a high-pathogenicity island (HPI) .

Function of Cardiolipin Synthase (Cls)

Cardiolipin synthase (Cls) is an enzyme (EC 2.7.8.-) that catalyzes the synthesis of cardiolipin . Cardiolipin is a unique phospholipid found in bacterial membranes and plays crucial roles in various cellular processes .

Recombinant Production

Recombinant DNA technology allows for the production of Y. pseudotuberculosis serotype O:1b Cls in host organisms . This involves cloning the cls gene from Y. pseudotuberculosis serotype O:1b into an expression vector and introducing the vector into a host organism, such as Escherichia coli, for protein production. The recombinant protein can then be purified for research purposes .

Applications

Recombinant Y. pseudotuberculosis serotype O:1b Cls is valuable for research applications, including:

  • Enzyme Activity Assays: Studying the enzymatic activity of Cls and its role in cardiolipin synthesis.

  • Structural Studies: Determining the three-dimensional structure of Cls to understand its mechanism of action.

  • Drug Discovery: Identifying potential inhibitors of Cls as novel antibacterial agents.

  • ELISA assays: Recombinant Yersinia pseudotuberculosis serotype O:1b Cardiolipin synthase(cls) can be used in ELISA assays .

Experimental Data

There is no specific experimental data available in the provided documents regarding Recombinant Yersinia pseudotuberculosis serotype O:1b Cardiolipin synthase (cls).

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notice is required, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. We recommend adding 5–50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
clsA; cls; YpsIP31758_1953; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, producing cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) and what is its function in Yersinia pseudotuberculosis?

Cardiolipin synthase (cls) in Yersinia pseudotuberculosis is an enzyme responsible for the synthesis of cardiolipin, a unique phospholipid with four acyl chains that plays crucial roles in bacterial membrane structure and function. The enzyme catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol. In bacterial systems, cardiolipin is particularly enriched at cell poles and division sites, suggesting its importance in cell division processes .

The cls enzyme in Y. pseudotuberculosis, like in other bacteria, is integral to maintaining proper membrane phospholipid composition, which affects membrane curvature, stability, and function. Cardiolipin has been implicated in various cellular processes including energy metabolism, osmotic stress response, and potentially pathogenesis .

How is the cls gene designated in Y. pseudotuberculosis genome annotations?

The cardiolipin synthase gene in Y. pseudotuberculosis serotype O:1b is designated by several names in genomic databases:

  • Primary gene name: clsA

  • Synonyms: cls, YpsIP31758_1953

  • Protein names: Cardiolipin synthase A, CL synthase

  • UniProt ID: A7FI50

This nomenclature is important for researchers conducting comparative genomic analyses or designing gene-specific primers for cloning or expression studies.

What expression systems are recommended for recombinant production of Y. pseudotuberculosis cls?

For recombinant production of Y. pseudotuberculosis cls, E. coli expression systems have been successfully employed. The commercially available recombinant form utilizes an N-terminal His-tag for purification purposes . When designing expression constructs, consider:

  • Expression vector selection: pET series vectors under T7 promoter control provide high-level expression in E. coli DE3 strains.

  • Affinity tag placement: N-terminal His-tags appear effective for cls purification without compromising activity.

  • Expression conditions: Due to the membrane-associated nature of cls, induction parameters (temperature, IPTG concentration) should be optimized to prevent inclusion body formation.

  • Membrane fraction preparation: Since cls is a membrane protein, extraction protocols using mild detergents (DDM, LDAO) are recommended for solubilization.

For functional studies, ensure that the expression construct preserves the native topological orientation of the protein's catalytic domain relative to the membrane.

What are effective methods for measuring cardiolipin synthase activity in vitro?

Several approaches can be employed to measure cardiolipin synthase activity:

Table 1: Methods for Assessing Cardiolipin Synthase Activity

MethodDescriptionAdvantagesLimitations
LC-MS AnalysisMonitors substrate consumption and product formation using liquid chromatography-mass spectrometryHigh sensitivity; can detect reaction intermediatesRequires specialized equipment and expertise
Radioactive Substrate AssayUses 14C or 32P labeled phosphatidylglycerol to track product formationHigh sensitivity; quantitativeHazardous materials; disposal concerns
Fluorescent Substrate AssayEmploys fluorescently-labeled phospholipid substratesReal-time monitoring possible; safer than radioactive methodsPotential interference of fluorophore with enzyme activity
Coupled Enzyme AssayMeasures glycerol release through coupling to glycerol kinase and glycerol-3-phosphate dehydrogenaseCan be adapted to high-throughput formatIndirect measurement; potential interference from coupling enzymes

For Y. pseudotuberculosis cls, an in vitro assay utilizing purified enzyme and synthetic or extracted phosphatidylglycerol (PG) substrates can be established. LC-MS analysis effectively confirms cardiolipin formation, as demonstrated with archaeal cardiolipin synthase where conversion of archaetidylglycerol to glycerol-di-archaetidyl-cardiolipin was monitored .

How can researchers purify active recombinant Y. pseudotuberculosis cardiolipin synthase?

Purification of active recombinant Y. pseudotuberculosis cardiolipin synthase requires careful consideration of its membrane protein nature. A recommended protocol includes:

  • Expression in E. coli with appropriate tags (His-tag is commonly used)

  • Harvesting cells and preparing membrane fractions through differential centrifugation

  • Solubilization of membrane proteins using mild detergents (DDM, LDAO, or CHAPS at 1-2%)

  • Affinity chromatography using Ni-NTA for His-tagged protein

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

Critical considerations include:

  • Maintaining detergent concentration above critical micelle concentration throughout purification

  • Including glycerol (10-20%) in buffers to enhance protein stability

  • Optimizing salt concentration (typically 150-300 mM NaCl) to minimize aggregation

  • Considering addition of phospholipids during purification to maintain enzyme structure and activity

The final purified protein can be stored as aliquots at -80°C in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, and detergent at concentrations just above CMC .

What role does cardiolipin play in bacterial membrane organization and how does this impact Y. pseudotuberculosis physiology?

Cardiolipin significantly influences bacterial membrane properties through several mechanisms:

  • Membrane curvature induction: The conical shape of cardiolipin promotes negative membrane curvature, concentrating at cell poles and division sites.

  • Microdomains formation: Cardiolipin can create specialized membrane domains that recruit specific proteins.

  • Proton trap function: Cardiolipin can function as a proton trap near respiratory complexes, enhancing energy transduction efficiency.

  • Osmotic stress response: Cardiolipin content often increases during osmotic stress, contributing to membrane stability.

In Y. pseudotuberculosis specifically, these properties may impact:

  • Cell division processes, potentially influencing bacterial replication rates during infection

  • Energy metabolism, affecting survival under nutrient-limited conditions

  • Stress responses, particularly during host-induced stresses like osmotic changes or antimicrobial peptide exposure

  • Possibly membrane protein organization and function, including virulence-associated secretion systems

The dynamic modulation of cardiolipin content and distribution via cls activity represents a potential adaptive mechanism during pathogenesis, though direct experimental evidence in Y. pseudotuberculosis would be needed to confirm these hypotheses.

How can recombinant Y. pseudotuberculosis cardiolipin synthase be used in membrane engineering applications?

Recombinant Y. pseudotuberculosis cardiolipin synthase offers potential applications in membrane engineering, particularly for creating specialized liposomes or bacterial membrane models with defined cardiolipin content. Potential research applications include:

  • In vitro membrane reconstitution systems: Purified cls can be incorporated into proteoliposomes along with other membrane proteins to study how cardiolipin affects their function.

  • Creation of biomimetic membranes: cls-containing systems can generate cardiolipin-rich membranes that mimic bacterial polar regions or division sites.

  • Enzymatic production of diverse cardiolipin species: Studies with archaeal cardiolipin synthases have demonstrated their ability to create diverse natural and unnatural phospholipids . Y. pseudotuberculosis cls might similarly be exploited to generate novel cardiolipin variants with unique properties.

  • Lipid-protein interaction studies: Recombinant cls can facilitate investigation of specific interactions between cardiolipin and membrane proteins, particularly those involved in respiration or division.

The catalytic mechanism of cardiolipin synthases, involving transphosphatidylation reactions, potentially enables the creation of asymmetric membrane systems that more accurately reflect native bacterial membrane architecture.

What is known about the substrate specificity of Y. pseudotuberculosis cardiolipin synthase?

Bacterial cardiolipin synthases typically utilize phosphatidylglycerol (PG) as their primary substrate, catalyzing the condensation of two PG molecules to form cardiolipin and glycerol. The enzyme might exhibit preferences for certain acyl chain compositions within PG molecules, which would influence the final cardiolipin species produced.

Studies with archaeal cardiolipin synthase have revealed significant substrate promiscuity, allowing for the creation of diverse phospholipids . This enzyme can utilize archaetidylglycerol (AG) to produce archaeal cardiolipin analogs. Similar exploration of Y. pseudotuberculosis cls substrate range could reveal:

  • Tolerance for different acyl chain lengths and saturations in PG substrates

  • Potential activity with non-native substrates like phosphatidylethanolamine or phosphatidylcholine

  • Capacity to create hybrid cardiolipins with mixed acyl chain compositions

Experimental approaches to investigate substrate specificity would include in vitro enzyme assays with various phospholipid substrates followed by LC-MS analysis of reaction products, similar to methods employed with archaeal cls .

How might cardiolipin synthase activity contribute to Y. pseudotuberculosis pathogenesis?

While direct evidence linking Y. pseudotuberculosis cardiolipin synthase to pathogenesis is limited in the available literature, several mechanisms can be proposed based on cardiolipin's known functions:

  • Survival under stress conditions: During infection, Y. pseudotuberculosis encounters various stresses including pH changes, osmotic shifts, and antimicrobial peptides. Cardiolipin's role in stress response could enhance bacterial survival in these conditions.

  • Energy metabolism support: Cardiolipin's interaction with respiratory complexes might optimize energy production during infection, particularly under oxygen-limited conditions found in certain host niches.

  • Membrane organization for virulence factor delivery: Proper localization and function of type III secretion systems and other virulence-associated membrane complexes might depend on cardiolipin-rich membrane domains.

  • Resistance to host defense mechanisms: Cardiolipin's contribution to membrane stability and impermeability could enhance resistance to host antimicrobial peptides and other innate immune defenses.

  • Adaptation to host temperature: Changes in cardiolipin content and composition during temperature shifts from environmental to host conditions (37°C) might facilitate adaptation during infection.

Research approaches to investigate these potential contributions could include:

  • Creation and characterization of cls knockout or conditional mutants

  • Lipidomic analysis of membrane composition changes during infection-relevant conditions

  • Virulence testing of cls mutants in appropriate animal models

  • Microscopy studies examining colocalization of virulence factors with cardiolipin-rich domains

How do the properties of Y. pseudotuberculosis cardiolipin synthase compare to other bacterial cls enzymes?

Y. pseudotuberculosis cardiolipin synthase (ClsA) shares several features with cardiolipin synthases from other bacterial species, while potentially possessing unique characteristics that may reflect adaptation to its specific ecological niche:

Table 2: Comparison of Bacterial Cardiolipin Synthases

FeatureY. pseudotuberculosis ClsAE. coli ClsAOther Bacterial ClsA
Protein Length486 amino acids Approximately 490 amino acidsVariable, typically 450-500 amino acids
Catalytic MechanismPhospholipase D-like activity (inferred)Phospholipase D-like activityTypically phospholipase D-like activity
Topological FlexibilityUnknown, potentially similar to E. coliDemonstrated ability to flip catalytic domain between membrane leaflets Variable, less characterized in most species
Gene ContextclsA (YpsIP31758_1953) clsAOften conserved gene neighborhood with phospholipid biosynthesis genes
Temperature AdaptationAdapted to function at both environmental and host temperatures (25-37°C)Optimal activity at 37°CVaries by species and ecological niche

A notable feature observed in E. coli ClsA is its ability to undergo topological inversion, flipping its catalytic domain between the cytoplasmic and periplasmic leaflets of the inner membrane in response to environmental conditions . This flexibility allows the enzyme to supply cardiolipin to the appropriate membrane leaflet as needed. It remains to be determined whether Y. pseudotuberculosis ClsA possesses similar topological plasticity, though evolutionary conservation suggests it might.

What evolutionary insights can be gained from studying Y. pseudotuberculosis cardiolipin synthase?

Evolutionary analysis of Y. pseudotuberculosis cardiolipin synthase offers several insights into bacterial membrane adaptation and the evolution of phospholipid biosynthesis:

  • Conservation across bacterial taxa: The presence of cardiolipin synthases across diverse bacterial phyla indicates the ancient origin and fundamental importance of cardiolipin in bacterial physiology.

  • Relationship to eukaryotic cardiolipin biosynthesis: Comparative analysis between bacterial cls and eukaryotic cardiolipin synthases (which use different mechanisms) illuminates the convergent evolution of cardiolipin biosynthesis.

  • Adaptation to environmental niches: Y. pseudotuberculosis must adapt to both environmental temperatures and mammalian host conditions (37°C). Examining whether its cls has evolved specific features to accommodate this temperature range could reveal mechanisms of environmental adaptation.

  • Horizontal gene transfer assessment: Analysis of cls gene sequences across Yersinia species can help determine whether horizontal gene transfer has played a role in cls evolution within this genus.

  • Structural adaptations: Comparative structural modeling of Y. pseudotuberculosis cls against archaeal and other bacterial homologs might reveal specific adaptations in substrate binding sites or catalytic regions.

The remarkable topological flexibility observed in E. coli cardiolipin synthase raises interesting evolutionary questions about how membrane protein topology can be selected for dynamic response to environmental conditions, potentially representing a novel mechanism of bacterial adaptation.

What are common pitfalls in working with recombinant Y. pseudotuberculosis cardiolipin synthase and how can they be addressed?

Researchers working with recombinant Y. pseudotuberculosis cardiolipin synthase often encounter several challenges due to its nature as a membrane protein. Here are common issues and potential solutions:

Challenge 1: Poor expression yields

  • Solution: Optimize expression conditions by:

    • Lowering induction temperature (16-20°C)

    • Reducing IPTG concentration (0.1-0.5 mM)

    • Using specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Testing different fusion tags (MBP tag often improves membrane protein solubility)

Challenge 2: Protein aggregation during purification

  • Solution:

    • Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

    • Include glycerol (10-20%) in all buffers

    • Add phospholipids during purification to stabilize the protein

    • Consider amphipol exchange for long-term stability

Challenge 3: Loss of enzyme activity

  • Solution:

    • Minimize freeze-thaw cycles by storing aliquots

    • Reconstitute into proteoliposomes to maintain native-like environment

    • Include reducing agents in buffers to protect cysteine residues

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Challenge 4: Difficulty measuring enzyme activity

  • Solution:

    • Ensure appropriate substrate preparation (PG liposomes may need sonication)

    • Optimize reaction conditions (temperature, pH, divalent cations)

    • Consider radiometric assays for highest sensitivity

    • Use LC-MS to directly confirm product formation

How can researchers distinguish between different cardiolipin synthase homologs in Yersinia species?

Yersinia species, including Y. pseudotuberculosis, may contain multiple cardiolipin synthase homologs (typically designated ClsA, ClsB, and ClsC in enterobacteria). Distinguishing between these homologs requires several complementary approaches:

  • Sequence-based identification:

    • Perform phylogenetic analysis using reference sequences from well-characterized species

    • Examine conserved domains and catalytic motifs specific to each cls type

    • Analyze synteny (gene neighborhood conservation) which often differs between cls homologs

  • Functional characterization:

    • Compare substrate preferences using in vitro assays with purified enzymes

    • Analyze lipid composition changes in single and multiple cls knockout mutants

    • Examine expression patterns under different growth conditions using qRT-PCR

  • Localization studies:

    • Generate fluorescent protein fusions to determine subcellular localization

    • Use fractionation approaches combined with western blotting to confirm membrane association

    • Perform protease accessibility assays to determine topological orientation

  • Expression profiling:

    • Monitor expression levels of different cls homologs under various stress conditions

    • Determine if homologs are differentially regulated during infection processes

    • Identify transcription factors controlling expression of each homolog

By combining these approaches, researchers can build a comprehensive understanding of the distinct roles of cardiolipin synthase homologs in Yersinia species, which may reveal specialized functions related to environmental adaptation or pathogenesis.

What are promising future research directions for Y. pseudotuberculosis cardiolipin synthase studies?

Several promising research avenues exist for advancing our understanding of Y. pseudotuberculosis cardiolipin synthase:

  • Topological dynamics investigation: Building on discoveries in E. coli ClsA , determine whether Y. pseudotuberculosis cls exhibits similar topological inversions in response to environmental stimuli, and identify the molecular triggers for such rearrangements.

  • Structure-function analysis: Obtain high-resolution structures of Y. pseudotuberculosis cls through cryo-electron microscopy or X-ray crystallography to elucidate the molecular basis of catalysis and membrane interaction.

  • Cardiolipin distribution visualization: Develop fluorescent cardiolipin-specific probes to visualize dynamic changes in cardiolipin distribution during Y. pseudotuberculosis infection processes.

  • Host-pathogen interface studies: Investigate how cardiolipin content affects Y. pseudotuberculosis interactions with host cells, particularly focusing on:

    • Resistance to host antimicrobial peptides

    • Membrane remodeling during intracellular survival

    • Impact on secretion system function and effector delivery

  • Inhibitor development: Design specific inhibitors of Y. pseudotuberculosis cls as potential antimicrobial agents, capitalizing on structural differences between bacterial and eukaryotic cardiolipin biosynthesis pathways.

  • Enzyme engineering applications: Explore the substrate promiscuity of Y. pseudotuberculosis cls for generating novel phospholipids with unique properties, similar to work done with archaeal cardiolipin synthases .

  • Systems biology integration: Incorporate cardiolipin synthesis into comprehensive models of Y. pseudotuberculosis membrane adaptations during infection, connecting membrane composition to virulence gene expression.

These research directions promise to deepen our understanding of bacterial membrane biology while potentially revealing new therapeutic targets against Yersinia infections.

What technological advances might enhance research on bacterial cardiolipin synthases?

Emerging technologies offer exciting possibilities for advancing research on Y. pseudotuberculosis cardiolipin synthase and related bacterial enzymes:

  • Cryo-electron tomography advancements: Improved resolution in cellular tomography could allow visualization of cardiolipin distribution and cls localization in intact bacterial cells under native-like conditions.

  • Advanced lipidomics techniques: More sensitive mass spectrometry approaches enable detection of cardiolipin molecular species with unprecedented detail, revealing subtle changes in acyl chain composition under different conditions.

  • Genome editing tools: CRISPR-Cas systems optimized for Y. pseudotuberculosis would facilitate precise genetic manipulation of cls genes and regulatory elements.

  • Artificial membrane systems: Droplet interface bilayers and microfluidic approaches for measuring enzymatic activity in defined membrane environments could provide new insights into cls function.

  • Single-molecule techniques: Fluorescence resonance energy transfer (FRET) and high-speed atomic force microscopy could reveal conformational changes in cls during catalysis or topological inversions.

  • In silico simulation advances: Improved molecular dynamics simulations of membrane proteins in complex lipid environments will help predict cls behavior and substrate interactions.

  • Synthetic biology approaches: Cell-free expression systems combined with artificial membrane scaffolds could enable rapid screening of cls variants and potential inhibitors.

Integration of these technologies promises to provide unprecedented insights into the molecular mechanisms of cardiolipin synthesis and its role in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.