Recombinant Yersinia pseudotuberculosis serotype O:1b Fumarate reductase subunit C (frdC)

What is Fumarate reductase subunit C (frdC) in Yersinia pseudotuberculosis and what is its basic function?

Fumarate reductase subunit C (frdC) in Y. pseudotuberculosis serotype O:1b is a 130-amino acid membrane protein that serves as an essential component of the fumarate reductase complex. This protein functions primarily as a membrane anchor, securing the catalytic components of the fumarate reductase complex to the cytoplasmic membrane .

The fumarate reductase complex catalyzes the reduction of fumarate to succinate during anaerobic respiration. Based on homology studies with other bacteria, the Y. pseudotuberculosis frdC likely contains multiple transmembrane helices with conserved histidine residues that coordinate heme B molecules, which are critical for electron transfer across the membrane .

What are the optimal methods for expressing recombinant Y. pseudotuberculosis frdC in heterologous systems?

Successful expression of recombinant Y. pseudotuberculosis serotype O:1b frdC requires careful optimization of several parameters:

Expression system optimization:

• Vector selection: The documented successful approach uses an N-terminal His-tagged construct expressed in E. coli . Consider vectors with tightly regulated promoters (T7, araBAD) to control expression levels.

• E. coli strain selection: For membrane proteins like frdC, specialized strains such as C41(DE3), C43(DE3), or Lemo21(DE3) often provide better results by accommodating the potentially toxic effects of membrane protein overexpression.

• Induction conditions:

  • Temperature: Lower temperatures (16-20°C) typically improve membrane protein folding

  • Inducer concentration: For IPTG-inducible systems, concentrations of 0.1-0.5 mM are recommended

  • Duration: Extended induction periods (16-24 hours) at lower temperatures often yield better results

Considerations for membrane protein expression:

• Co-expression with chaperones may improve folding and membrane insertion

• Addition of specific lipids or detergents to the growth medium can enhance stability

• Fusion partners such as MBP or SUMO can improve solubility and expression levels

What purification strategies yield highest purity and activity for recombinant frdC?

Purification of recombinant Y. pseudotuberculosis frdC requires specialized approaches for membrane proteins:

Membrane extraction and solubilization:

• Harvest cells and disrupt by sonication or high-pressure homogenization in buffer containing protease inhibitors

• Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

• Solubilize membranes with appropriate detergents (common options include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at 1-2% concentrations)

Affinity chromatography:

• Apply solubilized protein to Ni-NTA or similar IMAC resin

• Wash with buffer containing 20-50 mM imidazole and 0.1-0.2% detergent

• Elute with buffer containing 250-500 mM imidazole and 0.05-0.1% detergent

Size exclusion chromatography:

• Apply concentrated affinity-purified protein to a suitable SEC column

• Elute with buffer containing 0.05% detergent to separate monomeric protein from aggregates

Buffer optimization:

• Include glycerol (10-20%) to improve stability

• Maintain detergent concentration above its critical micelle concentration

• Consider including specific lipids that might stabilize the protein

The purified protein can be stored as a lyophilized powder or in solution with appropriate stabilizers .

What are the optimal storage conditions for maintaining stability and activity of purified recombinant frdC?

Based on commercial recommendations for recombinant Y. pseudotuberculosis serotype O:1b frdC :

Short-term storage:

• Store working aliquots at 4°C for up to one week

• Maintain detergent concentration above critical micelle concentration

• Avoid repeated freeze-thaw cycles

Long-term storage options:

• Lyophilization: The most stable form for extended storage

  • Store lyophilized powder at -20°C to -80°C

  • Protect from moisture with desiccant

• Solution storage with cryoprotectants:

  • Add glycerol to a final concentration of 50% (or 5-50% range)

  • Aliquot to minimize freeze-thaw cycles

  • Store at -20°C to -80°C

Reconstitution protocol:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Allow complete rehydration before use

Stability monitoring:

• Assess protein integrity by SDS-PAGE after storage periods

• Monitor activity using appropriate enzymatic assays

• Check for aggregation using light scattering or size exclusion chromatography

How can researchers assess the dual-functioning role of fumarate reductase in bacterial metabolism?

Fumarate reductase in bacteria like Y. pseudotuberculosis demonstrates a fascinating dual functionality, serving both as a fumarate reductase and a succinate dehydrogenase. This allows the bacterium to adapt to varying oxygen conditions. To assess this dual role:

Fumarate reductase activity assay:

• Prepare reaction mixture containing:

  • 50 mM phosphate buffer (pH 7.4)

  • 10 mM fumarate

  • 0.8 mM benzyl viologen (pre-reduced with sodium dithionite)

  • Purified enzyme or membrane fraction

• Monitor the oxidation of reduced benzyl viologen spectrophotometrically at 578 nm

• Calculate activity as μmol fumarate reduced/min/mg protein

Succinate dehydrogenase activity assay:

• Prepare reaction mixture containing:

  • 50 mM phosphate buffer (pH 7.4)

  • 10 mM succinate

  • 0.1 mM DCPIP (2,6-dichlorophenolindophenol)

  • Purified enzyme or membrane fraction

• Monitor the reduction of DCPIP spectrophotometrically at 600 nm

• Calculate activity as μmol succinate oxidized/min/mg protein

Comparative enzyme kinetics:
Compare the kinetic parameters (Km, Vmax) for both reactions to understand the enzyme's preference for each direction.

Experimental controls:

• Frd/Sdh inhibitors (e.g., malonate, oxaloacetate)

• Testing at different oxygen tensions

• Mutation of key residues

Studies with C. jejuni have demonstrated that the FrdCAB complex can be the sole succinate dehydrogenase in some bacteria, a functional characteristic that may be shared with Y. pseudotuberculosis frdC .

How does Y. pseudotuberculosis frdC compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis reveals important similarities and differences between Y. pseudotuberculosis frdC and homologous proteins:

Key functional differences:

• Unlike W. succinogenes frdC, which shows robust activity with artificial electron donors/acceptors, the Y. pseudotuberculosis frdC (similar to C. jejuni) may have more restricted substrate specificity .

• The arrangement and number of transmembrane helices affect the efficiency of proton/electron coupling, potentially impacting the energy conservation efficiency during respiration.

• Y. pseudotuberculosis frdC likely functions as part of a complex that serves as both fumarate reductase and succinate dehydrogenase, similar to what has been observed in C. jejuni, where "FrdCAB is the sole succinate dehydrogenase" .

What methodological approaches can elucidate the role of frdC in Y. pseudotuberculosis pathogenicity?

While the direct contribution of frdC to Y. pseudotuberculosis virulence remains to be fully characterized, several methodological approaches can help elucidate its role:

Gene deletion and complementation studies:

• Generate frdC deletion mutants in Y. pseudotuberculosis

• Assess growth under aerobic and anaerobic conditions

• Complement with wild-type and mutant versions of frdC

• Compare growth rates, metabolic profiles, and virulence characteristics

Animal infection models:

• Compare wild-type and frdC mutant strains in mouse infection models

• Assess colonization efficiency, tissue dissemination, and survival using methods similar to those described for Y. pseudotuberculosis vaccine strains

• Measure inflammatory responses and histopathological changes

Metabolic characterization during infection:

• Use metabolomic approaches to identify metabolic shifts in frdC mutants

• Assess succinate/fumarate ratios in tissues during infection

• Measure expression of frdC under various infection-relevant conditions

Host cell interaction studies:

• Macrophage survival and replication assays

• Analyze metabolic adaptation within host cells

• Study the effect of frdC deletion on intracellular energy production

Research with Y. pseudotuberculosis has shown that metabolic adaptability is crucial for pathogenesis. Given that Y. pseudotuberculosis can cause various conditions from enteritis to systemic infection , the dual-function nature of the fumarate reductase complex may provide metabolic flexibility vital for adaptation to different host environments.

What structural analysis techniques are most appropriate for studying membrane-bound frdC?

Studying the structure of membrane proteins like Y. pseudotuberculosis frdC presents unique challenges. Several complementary techniques can be employed:

X-ray crystallography:

• Purify recombinant frdC in appropriate detergents

• Screen various detergents, lipids, and crystallization conditions

• Consider lipidic cubic phase (LCP) crystallization for membrane proteins

• Use antibody fragments or designed ankyrin repeat proteins (DARPins) as crystallization chaperones

Cryo-electron microscopy (cryo-EM):

• Particularly valuable for the entire fumarate reductase complex

• Prepare samples in detergent micelles, nanodiscs, or amphipols

• Use single-particle analysis for high-resolution structure determination

• Focus on conformational states relevant to catalytic activity

NMR spectroscopy:

• Solution NMR with detergent-solubilized protein for flexible regions

• Solid-state NMR for transmembrane domains

• Targeted studies of specific residues (e.g., histidines involved in heme coordination)

Molecular dynamics simulations:

• Model the protein in a lipid bilayer environment

• Simulate interactions with other subunits of the complex

• Investigate conformational changes during catalytic cycle

• Validate with experimental data from cross-linking or spectroscopic studies

EPR spectroscopy:

• Particularly useful for studying the heme environments

• Spin labeling of specific residues to map conformational changes

• Distance measurements between strategically placed spin labels

These methods can provide crucial insights into how the five transmembrane helices of frdC are arranged, how the conserved histidine residues coordinate heme B molecules, and how electron transfer occurs through the protein.

How can researchers investigate the interaction between frdC and other components of the fumarate reductase complex?

Understanding the interactions between frdC and other components of the fumarate reductase complex requires specialized approaches:

Co-purification and co-expression strategies:

• Co-express frdC with frdA and frdB subunits in E. coli

• Use tandem affinity purification with different tags on different subunits

• Assess complex formation by size exclusion chromatography and native PAGE

Protein-protein interaction mapping:

• Cross-linking coupled with mass spectrometry to identify interaction interfaces

• Hydrogen-deuterium exchange mass spectrometry to map binding regions

• FRET-based approaches to study dynamic interactions

• Biolayer interferometry or surface plasmon resonance to measure binding kinetics

Functional reconstitution:

• Purify individual subunits (frdA, frdB, frdC)

• Reconstitute in proteoliposomes with appropriate lipids

• Measure activity to assess proper complex assembly

• Compare with naturally isolated complex

Mutagenesis studies:

• Identify conserved residues at predicted interaction interfaces

• Generate point mutations and assess impact on complex formation and activity

• Create chimeric proteins with frdC from other species to identify species-specific interactions

A systematic investigation using these approaches can reveal how the 130-amino acid frdC protein (with sequence MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVASAIILAVALL) interacts with other components to form a functional enzyme complex.

What are the most common challenges in working with recombinant frdC and how can they be addressed?

Working with recombinant Y. pseudotuberculosis frdC presents several challenges common to membrane proteins. Here are systematic approaches to address them:

Expression challenges:

Purification challenges:

Activity assessment challenges:

The documented successful expression of recombinant Y. pseudotuberculosis frdC as a His-tagged protein in E. coli suggests that with proper optimization, many of these challenges can be overcome .

What quality control measures should be implemented when working with recombinant frdC?

Rigorous quality control is essential when working with recombinant Y. pseudotuberculosis frdC to ensure reliable experimental results:

Protein identity verification:

• Mass spectrometry analysis to confirm primary sequence

• N-terminal sequencing to verify intact protein

• Western blot with anti-His antibodies to confirm tag presence

• Peptide mapping to achieve comprehensive sequence coverage

Purity assessment:

• SDS-PAGE with Coomassie staining (aim for >90% purity)

• Silver staining for detection of minor contaminants

• Size exclusion chromatography to assess monodispersity

• Dynamic light scattering to detect aggregates

Structural integrity:

• Circular dichroism to confirm secondary structure elements

• Fluorescence spectroscopy to assess tertiary structure

• Thermal shift assays to evaluate stability

• Heme incorporation analysis for proper cofactor binding

Functional validation:

• Enzymatic activity assays (fumarate reduction and succinate oxidation)

• Reconstitution with other subunits to form functional complex

• Proteoliposome reconstitution to assess membrane integration

• Electron transfer capability tests

Critical batch-to-batch comparisons:

• Maintain reference standards from successful preparations

• Compare specific activity between batches

• Document purification yields and specific activities

• Implement statistical process control

Storage stability monitoring:

• Test activity retention after defined storage periods

• Compare fresh vs. stored protein by multiple parameters

• Document stability profiles under different storage conditions

Following these quality control measures will ensure consistent, high-quality recombinant frdC preparations suitable for advanced functional and structural studies.

What biosafety precautions are required when working with Y. pseudotuberculosis components?

Working with Y. pseudotuberculosis components, including recombinant frdC, requires adherence to specific biosafety practices:

Laboratory containment requirements:

• Y. pseudotuberculosis is classified as a Risk Group 2 pathogen

• Biosafety Level 2 (BSL-2) practices, containment equipment, and facilities are required

• All work should be conducted in compliance with institutional biosafety guidelines

Personal protective equipment (PPE):

• Laboratory coats must be worn and not taken home

• Gloves must be worn when handling materials

• Eye protection is required when there is potential for splashes or aerosols

• PPE should be removed before leaving the laboratory area

Engineering controls:

• Certified biosafety cabinet should be used for procedures that may generate aerosols

• Centrifugation should be performed in sealed rotors or safety cups

• Mechanical pipetting devices should be used (no mouth pipetting)

• Hand washing facilities must be readily available

Decontamination procedures:
Y. pseudotuberculosis is susceptible to the following disinfectants :

• 2-5% phenol

• 1% sodium hypochlorite

• 70% ethanol

• 4% formaldehyde

• 2% glutaraldehyde

• 2% peracetic acid

• 3-6% hydrogen peroxide

• 0.16% iodine

Special considerations for susceptible personnel:

• Individuals with compromised immune systems are at increased risk

• Persons with iron overload conditions (hemochromatosis, cirrhosis, hemolytic anemia) are at higher risk for severe infections

• Additional precautions may be warranted for these individuals

Medical surveillance:

• Laboratory personnel should be aware of the symptoms of Y. pseudotuberculosis infection (abdominal pain, diarrhea, rash, fever)

• Post-exposure procedures should be established and followed if exposure occurs

What regulatory frameworks govern research with recombinant Y. pseudotuberculosis proteins?

Research involving recombinant Y. pseudotuberculosis proteins is subject to several regulatory frameworks that researchers must navigate:

Biosafety regulations:

• National biosafety regulations (varies by country)

• Institutional Biosafety Committee (IBC) approval requirements

• Risk assessment documentation for work with pathogen-derived materials

• Training requirements for personnel

Material transfer considerations:

• Material Transfer Agreements (MTAs) for acquisition of Y. pseudotuberculosis strains or components

• Import/export permits for international shipment of biological materials

• Proper documentation of material provenance and use restrictions

Recombinant DNA oversight:

• NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules (in the US)

• Equivalent national guidelines in other countries

• Proper registration of recombinant DNA experiments with institutional committees

Data management and sharing:

• Proper documentation of experimental protocols involving pathogen components

• Data sharing considerations for pathogen-related research

• Potential publication restrictions for methods that could be misused

Intellectual property considerations:

• Patent landscape around Y. pseudotuberculosis proteins and their applications

• Material ownership and rights to derivatives

• Licensing requirements for commercial applications

While the recombinant frdC protein itself is unlikely to pose significant biosecurity concerns, researchers should be aware that work with Y. pseudotuberculosis components falls under broader regulatory frameworks designed to ensure responsible research with potentially pathogenic organisms.