Recombinant Yersinia pseudotuberculosis serotype O:1b Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Context

The lspA gene is chromosomally encoded in Y. pseudotuberculosis and shares high homology with Yersinia pestis (99–100% identity in O:1b strains) . This genetic conservation underscores its essential role in bacterial physiology.

Regulatory Networks

  • Csr System: Indirectly influenced by regulators like YmoA, which modulates CsrB/C RNAs to control virulence factors such as RovA and invasin .

  • Lipopolysaccharide (LPS) Biosynthesis: lspA interacts with genes like rfaH, which governs LPS core oligosaccharide synthesis and resistance to antimicrobial peptides .

Role in Pathogenesis

LspA-processed lipoproteins contribute to Y. pseudotuberculosis virulence through:

Immune Evasion Mechanisms

  • T3SS Effector Translocation: The Ysc-Yop type III secretion system (T3SS), encoded on the pYV plasmid, relies on lipoproteins for assembly and effector delivery into host cells .

  • Complement Resistance: Lipoproteins may synergize with outer membrane proteins like Ail to recruit host regulators (e.g., C4BP, factor H) and evade serum killing .

Host-Pathogen Interactions

  • CD209 Receptor Binding: Rough LPS variants (dependent on LspA-processed transporters) interact with dendritic cell receptors to facilitate dissemination .

  • Pyogranuloma Formation: LspA activity supports bacterial survival in mesenteric lymph nodes by countering phagocyte defenses .

Biotechnological Production and Applications

Recombinant LspA is produced via codon-optimized expression in E. coli, yielding soluble and active enzyme . Applications include:

Research Tools

  • Lipoprotein Processing Studies: Used to dissect maturation pathways in Yersinia and related pathogens.

  • Antigen Engineering: Modified Yersinia strains with altered lipid A (e.g., adjuvant MPLA) leverage LspA for membrane protein export .

Industrial Relevance

  • Vaccine Development: LspA-processed antigens are candidates for subunit vaccines targeting Y. pseudotuberculosis and Y. pestis .

Research Findings and Challenges

Key Studies

  • Genetic Knockout Models: ΔlspA mutants exhibit defective lipoprotein maturation, impaired membrane integrity, and attenuated virulence .

  • Structural Insights: Computational models predict LspA’s role in stabilizing the T3SS translocon .

Unresolved Questions

  • Regulatory Cross-Talk: How YmoA and Csr RNAs fine-tune lspA expression under stress conditions .

  • Host-Specific Adaptations: Role of LspA in zoonotic transitions (e.g., Y. pseudotuberculosis to Y. pestis) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; YpsIP31758_3459; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
lspA
Target Protein Sequence
MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPFFNLTYAQNFGAAFSF LADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGA VNDFLDFYINNWHFPTFNLADVAISIGAVLVIFEGFLSPAEKNAVNKNE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Lipoprotein signal peptidase (lspA) in Y. pseudotuberculosis serotype O:1b?

Lipoprotein signal peptidase (lspA) in Y. pseudotuberculosis serotype O:1b functions as an essential processing enzyme within the bacterial membrane. While specific lspA genomic data is limited in current literature, genome sequencing of Y. pseudotuberculosis IP31758 (serotype O:1b) has revealed a complex genetic landscape with significant differences from other Yersinia strains . The lspA gene likely resides within the core genome rather than on the novel plasmids identified in serotype O:1b strains. Its conservation across Yersinia species suggests its fundamental role in bacterial physiology, particularly in membrane integrity maintenance through proper lipoprotein processing.

How does lspA contribute to Y. pseudotuberculosis pathogenesis compared to Y. pestis?

The pathogenic mechanisms of Y. pseudotuberculosis involve multiple virulence factors, many of which are membrane-associated proteins potentially processed by lspA. Y. pseudotuberculosis serotype O:1b is the direct evolutionary ancestor of Y. pestis, with divergence occurring within the last 20,000 years . While Y. pestis has undergone reductive gene loss since emerging from Y. pseudotuberculosis, essential processing enzymes like lspA are likely conserved between these species . The proper functioning of lspA-processed lipoproteins contributes to bacterial colonization of lymphoid organs through effects on immune cells . Unlike Y. pestis, Y. pseudotuberculosis serotype O:1b strains associated with Far East scarlet-like fever (FESLF) contain unique virulence determinants, including chromosome-encoded protein toxins and novel plasmids that may interact with lspA-processed proteins .

Why is serotype O:1b significant in Y. pseudotuberculosis research?

Serotype O:1b of Y. pseudotuberculosis holds particular significance in bacterial evolution and pathogenesis research for several reasons:

Significance FactorDetails
Evolutionary RelationshipDirect ancestor of Y. pestis (plague bacterium)
Unique PathogenicityAssociated with Far East scarlet-like fever with distinctive clinical presentations
Genomic FeaturesContains novel plasmids and virulence factors not found in other serotypes
Vaccine Development PotentialServes as a platform for recombinant plague vaccine development
Immune ResponseGenerates distinct immune responses that may inform therapeutic strategies

These characteristics make serotype O:1b a critical target for research into bacterial evolution, pathogenesis mechanisms, and vaccine development strategies .

What methods are most effective for creating recombinant Y. pseudotuberculosis with modified lspA?

The development of recombinant Y. pseudotuberculosis strains with modified lspA can be accomplished through homologous recombination using suicide plasmids. Based on established protocols:

  • Design and synthesize homologous arm primers at both ends of the lspA gene segment

  • Clone gene fragments using PCR

  • Construct a suicide plasmid (e.g., pRE112-based) using homologous recombination principles

  • Transfer the recombinant plasmid into Y. pseudotuberculosis using electrical conversion methods

  • Screen positive strains through repeated antibiotic selection (e.g., LB agar with 50μg/mL Cm)

  • Confirm mutants through PCR identification

  • Perform final verification using sucrose screening (LB agar with 10% sucrose)

This methodology has been successfully employed for other gene modifications in Y. pseudotuberculosis, including lpxL mutations, and can be adapted for lspA targeting .

How can researchers express recombinant proteins in Y. pseudotuberculosis to study lspA function?

For expressing recombinant proteins in Y. pseudotuberculosis to investigate lspA function, researchers can utilize plasmid-based expression systems. An effective approach involves:

  • Selecting an appropriate plasmid backbone (e.g., Asd+ plasmid pSMV13) that provides stable maintenance

  • Designing expression constructs with suitable promoters for desired expression levels

  • Including appropriate selectable markers for strain verification

  • Transferring constructs into Y. pseudotuberculosis through electroporation

  • Verifying protein expression using SDS-PAGE and Western Blot analysis

This approach has successfully increased production of target proteins in Y. pseudotuberculosis, as demonstrated with LcrV antigen expression . For lspA functional studies, researchers could express wild-type or mutant variants of lspA, or substrate lipoproteins with modifications to study processing efficiency.

What considerations are important when designing lspA knockout or mutation strategies?

When designing lspA knockout or mutation strategies, several critical factors must be considered:

  • Essentiality Assessment: Since lspA may be essential for bacterial viability, conditional mutation approaches may be necessary

  • Mutation Design:

    • Complete gene deletion vs. point mutations affecting catalytic activity

    • In-frame deletions to prevent polar effects on downstream genes

    • Inclusion of marker genes for selection

  • Complementation Controls: Design complementation constructs with wild-type lspA under native or inducible promoters to verify phenotype specificity

  • Verification Methods: Employ multiple confirmation techniques:

    • PCR verification of genetic modifications

    • Sequencing to confirm precise alterations

    • Protein expression analysis to verify functional impacts

    • Phenotypic assays to assess membrane integrity and processing of substrate lipoproteins

  • Potential Compensatory Mechanisms: Consider the possibility of alternative processing pathways that might mask phenotypes

Research on Y. pseudotuberculosis has employed similar strategies for other genes, demonstrating the feasibility of targeted genetic manipulation in this organism .

How should researchers design experiments to measure lspA enzymatic activity in Y. pseudotuberculosis?

Designing experiments to measure lspA enzymatic activity in Y. pseudotuberculosis requires multiple complementary approaches:

  • In vitro assays:

    • Express and purify recombinant lspA

    • Generate synthetic lipoprotein substrates with fluorescent or other detectable tags

    • Measure cleavage rates under varying conditions (pH, temperature, cofactors)

    • Compare wild-type and mutant lspA activity profiles

  • In vivo approaches:

    • Create reporter constructs with known lspA substrates fused to detectable markers

    • Compare processing efficiency in wild-type versus lspA-modified strains

    • Use pulse-chase experiments to track lipoprotein maturation kinetics

  • Membrane fraction analysis:

    • Extract outer membrane fractions using ultrafiltration centrifugation methods

    • Analyze lipoprotein profiles using proteomic approaches

    • Compare precursor/mature lipoprotein ratios across strains with different lspA expression levels

  • Controls:

    • Include inhibitor controls (e.g., globomycin, a specific inhibitor of lipoprotein signal peptidase)

    • Compare with other Yersinia species (Y. pestis) for evolutionary insights

    • Utilize temperature-sensitive mutants if lspA is essential

These methodologies build upon established techniques for membrane protein analysis in Y. pseudotuberculosis .

What protocols are recommended for isolating outer membrane vesicles (OMVs) from lspA-modified Y. pseudotuberculosis strains?

For isolating outer membrane vesicles (OMVs) from lspA-modified Y. pseudotuberculosis strains, the following optimized protocol is recommended:

  • Bacterial Culture Preparation:

    • Inoculate strain on LB agar plates and culture overnight at 28°C

    • Transfer single colony to 5-mL LB liquid medium

    • Incubate at 28°C at 200 rpm until logarithmic growth phase

    • Scale up to 1-L LB liquid medium

  • OMV Extraction:

    • When culture reaches OD600 0.4–0.6, add 0.5M EDTA

    • Incubate on ice for 1 hour

    • Centrifuge bacterial suspension at 10,000 × g for 15 minutes at 4°C

    • Collect supernatant

    • Filter through 0.22-μm filter to remove remaining bacteria

    • Concentrate to 40 mL using cyclical ultrafiltration

  • OMV Purification and Characterization:

    • Further purify by ultracentrifugation or density gradient separation

    • Quantify OMV yield by protein concentration measurement

    • Verify OMV integrity by electron microscopy

    • Characterize protein content by SDS-PAGE and Western Blot

This protocol has been validated for Y. pseudotuberculosis OMV isolation and can be adapted to study how lspA modifications affect OMV composition and yield .

How can researchers evaluate the immunological effects of lspA-processed lipoproteins in Y. pseudotuberculosis?

To evaluate the immunological effects of lspA-processed lipoproteins in Y. pseudotuberculosis, a comprehensive approach including both in vitro and in vivo methodologies is necessary:

  • Immune Cell Response Assays:

    • Co-culture macrophages or dendritic cells with wild-type or lspA-modified strains

    • Measure cytokine production profiles (IL-6, TNF-α, IL-1β)

    • Assess phagocytic activity and bacterial survival within phagocytes

    • Analyze macrophage polarization toward M1 or M2 phenotypes

  • Receptor Interaction Studies:

    • Investigate interactions with pattern recognition receptors (TLR2, TLR4)

    • Compare binding affinities of lipoproteins from wild-type versus lspA-modified strains

    • Assess downstream signaling pathway activation

  • Animal Model Experiments:

    • Compare immune responses to wild-type versus lspA-modified strains in mouse models

    • Analyze antibody production and isotype profiles

    • Evaluate protective efficacy against challenge

    • Measure T-cell responses (Th1/Th2/Th17 polarization)

  • OMV Immunization Studies:

    • Isolate OMVs from wild-type and lspA-modified strains

    • Administer intramuscularly to mice (e.g., 40 μg doses)

    • Evaluate protection against various challenge routes (pulmonary, subcutaneous)

    • Compare efficacy to established vaccine formulations

These approaches can reveal how lspA-processed lipoproteins contribute to bacterial virulence and immune evasion strategies, building on established immunological research with Y. pseudotuberculosis .

How can lspA-modified Y. pseudotuberculosis strains be utilized in vaccine development?

LspA-modified Y. pseudotuberculosis strains offer significant potential for vaccine development, particularly as platforms for recombinant antigen delivery:

  • OMV-Based Vaccine Approaches:

    • LspA modifications can alter lipoprotein content in OMVs, potentially enhancing immunogenicity

    • Recombinant OMVs can serve as self-adjuvanting vaccine delivery systems

    • Target antigens can be engineered to associate with OMVs through lipoprotein anchoring

  • Strain Engineering Strategy:

    • Create detoxified strains with lspA modifications to reduce reactogenicity

    • Express heterologous antigens (like Y. pestis LcrV) in lspA-optimized backgrounds

    • Incorporate adjuvant forms of lipid A (monophosphoryl lipid A [MPLA])

  • Immunization Protocols:

    • Intramuscular administration (40 μg of purified OMVs) has demonstrated efficacy

    • Protection against multiple routes of infection (pulmonary, subcutaneous) has been achieved with similar approaches

    • Vaccination schedules can be optimized based on immune response kinetics

  • Protection Data:

    • Recombinant Y. pseudotuberculosis OMV vaccines have demonstrated superior protection compared to subunit vaccines

    • Complete protection against high-dose challenges (up to 50,000 LD50) has been achieved with optimized formulations

    • OMVs from engineered Y. pseudotuberculosis produce stronger protection than their Y. pestis counterparts

These approaches build on established successes with Y. pseudotuberculosis-based plague vaccines, where properly engineered strains provided complete protection against both pneumonic and bubonic plague challenges .

What role does lspA play in the formation and composition of outer membrane vesicles (OMVs)?

LspA plays a crucial but often overlooked role in OMV formation and composition in Y. pseudotuberculosis:

  • Impact on OMV Biogenesis:

    • Proper lipoprotein processing by lspA is essential for membrane stability

    • Alterations in lspA function likely affect membrane curvature and vesiculation rates

    • Lipoproteins processed by lspA serve as structural components that influence OMV size and morphology

  • OMV Composition Effects:

    • LspA-processed lipoproteins constitute significant components of OMVs

    • Improper processing can lead to altered lipoprotein incorporation and OMV protein profiles

    • Engineered modifications can be exploited to enrich specific proteins in OMVs

  • Immunological Properties:

    • LspA-processed lipoproteins in OMVs serve as pathogen-associated molecular patterns (PAMPs)

    • These components contribute to the self-adjuvanting properties of OMVs

    • Modifications to lspA can potentially modulate immune responses to OMVs

  • Experimental Evidence:

    • Y. pseudotuberculosis strains engineered to express heterologous antigens produce OMVs enclosing high amounts of target proteins

    • Recombinant Y. pseudotuberculosis produces dramatically increased OMV yields compared to Y. pestis counterparts

    • OMVs from engineered strains show distinct protein profiles that can be verified by SDS-PAGE and Western Blot

Understanding lspA's role in OMV biology provides opportunities to engineer strains with optimized OMV production for vaccine and drug delivery applications.

How does lspA function compare between Y. pseudotuberculosis and closely related pathogens?

The function and significance of lspA across Yersinia species and related pathogens reveals important evolutionary and pathogenic insights:

OrganismLspA CharacteristicsFunctional SignificanceEvolutionary Context
Y. pseudotuberculosis serotype O:1bProcesses virulence-associated lipoproteinsContributes to unique clinical manifestations including FESLFAncestral form with full enteric pathogen capabilities
Y. pestisConserved from Y. pseudotuberculosisEssential for plague pathogenesisEvolved from Y. pseudotuberculosis within past 20,000 years; underwent reductive evolution
Other Y. pseudotuberculosis serotypesMay have subtle functional variationsAssociated with classical pseudotuberculosis symptomsShow genomic heterogeneity compared to serotype O:1b
Y. enterocoliticaMore distantly related lspASpecialized for enteric infectionSeparated from Y. pseudotuberculosis lineage 0.4-1.9 million years ago

Key comparative insights:

  • Despite Y. pestis undergoing reductive evolution from Y. pseudotuberculosis, essential processing enzymes like lspA remain conserved, though potentially with regulatory differences

  • The lipoprotein processing pathway is fundamental across Gram-negative pathogens but may be adapted for specific host environments

  • Serotype O:1b of Y. pseudotuberculosis contains unique virulence determinants not found in other serotypes, which may interact with lspA-processed lipoproteins

  • Y. pseudotuberculosis shows greater genomic diversity and heterogeneity compared to Y. pestis, suggesting more varied lspA substrate profiles

These comparisons provide valuable context for understanding lspA function in bacterial pathogenesis and evolution.

What analytical methods are most appropriate for studying lspA function and its processed lipoproteins?

To comprehensively study lspA function and its processed lipoproteins in Y. pseudotuberculosis, researchers should employ multiple complementary analytical approaches:

  • Proteomic Analysis:

    • Mass spectrometry-based identification of lipoprotein N-terminal modifications

    • Comparative proteomics between wild-type and lspA-modified strains

    • Quantitative analysis of precursor/mature lipoprotein ratios

    • Signal peptide cleavage site mapping

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-EM of lspA protein

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Structure-function analysis through site-directed mutagenesis

  • Membrane Biology Techniques:

    • Membrane fractionation and lipoprotein extraction

    • Fluorescence microscopy with tagged lipoproteins

    • Membrane integrity and permeability assays

    • Atomic force microscopy of membrane structures

  • Biochemical Assays:

    • Western blotting with anti-lipoprotein antibodies

    • Pulse-chase experiments to track lipoprotein processing kinetics

    • In vitro enzymatic activity assays

    • Inhibitor studies (e.g., with globomycin)

These methods build upon established techniques used in Y. pseudotuberculosis research, including SDS-PAGE, Western blot, and membrane fraction isolation through ultrafiltration centrifugation .

How should researchers interpret conflicting data regarding lspA function or mutant phenotypes?

When encountering conflicting data regarding lspA function or mutant phenotypes in Y. pseudotuberculosis, researchers should employ a systematic troubleshooting approach:

  • Strain Background Considerations:

    • Verify genetic backgrounds of all strains (wild-type, mutant, complemented)

    • Sequence confirm all genetic modifications

    • Check for unintended secondary mutations

  • Technical Variable Analysis:

    • Standardize growth conditions (temperature, media, growth phase)

    • Control for laboratory-specific variables (equipment, reagents)

    • Verify all measurement techniques with appropriate standards

  • Biological Complexity Factors:

    • Consider potential compensatory mechanisms

    • Evaluate redundant processing pathways

    • Assess strain-specific differences in gene regulation

  • Experimental Design Evaluation:

    • Verify appropriate controls for each experiment

    • Review statistical approaches and sample sizes

    • Consider time-dependent effects and experimental timing

  • Reconciliation Strategies:

    • Design experiments specifically to address contradictions

    • Employ multiple independent techniques to measure the same parameter

    • Collaborate with laboratories reporting conflicting results for side-by-side experiments

Remember that Y. pseudotuberculosis employs "fine-tuning of immune system activity by toxins encoded by both a 70-kb plasmid and chromosomes, through various mechanisms of action of individual proteins and their interactions" , which contributes to the complexity of interpreting experimental results.

What are common technical challenges when working with recombinant Y. pseudotuberculosis strains, and how can they be addressed?

Working with recombinant Y. pseudotuberculosis strains presents several technical challenges, particularly when modifying essential genes like lspA:

  • Genetic Stability Issues:

    • Challenge: Recombinant constructs may be lost during prolonged cultivation

    • Solution: Maintain selection pressure; verify strain genotypes before experiments; prepare fresh cultures from verified frozen stocks

  • Expression Level Control:

    • Challenge: Inappropriate expression levels of lspA variants can mask phenotypes

    • Solution: Use titratable promoters; create expression constructs with varying promoter strengths; monitor expression levels via reporter fusions

  • Growth Condition Sensitivity:

    • Challenge: Phenotypes may only manifest under specific conditions

    • Solution: Test multiple growth conditions (temperature, pH, media); assess stress responses; evaluate phenotypes in host-mimicking conditions

  • Containment Requirements:

    • Challenge: Biosafety considerations limit experimental approaches

    • Solution: Develop attenuated strains; establish proper containment protocols; consider surrogate systems for high-risk experiments

  • OMV Isolation Difficulties:

    • Challenge: Low yields or contamination in OMV preparations

    • Solution: Optimize EDTA concentration; verify filter integrity; implement additional purification steps; standardize harvest timing

  • Phenotype Attribution:

    • Challenge: Determining whether observed effects are directly due to lspA modification

    • Solution: Create complementation constructs; perform epistasis experiments; conduct targeted biochemical assays for specific lipoprotein processing

These challenges can be addressed through careful experimental design, appropriate controls, and systematic optimization of protocols based on established methods for Y. pseudotuberculosis manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.