Recombinant Yersinia pseudotuberculosis serotype O:1b NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; YpsIP31758_1454; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
nuoA
Target Protein Sequence
MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSA RMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRI GALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does nuoA protein expression differ between pathogenic and non-pathogenic Yersinia strains?

Comparative proteomic analyses reveal that NADH-quinone oxidoreductase components, including nuoA, show expression level variations between pathogenic strains like Y. pseudotuberculosis serotype O:1b and non-pathogenic Yersinia species. In pathogenic strains, the expression of respiratory chain components is often regulated in response to environmental stressors, particularly during host infection .

Research methodology to investigate these differences typically involves:

  • Isolation of bacterial strains under identical growth conditions

  • Protein extraction and quantification using standardized protocols

  • Comparative proteomic analysis using techniques such as:

    • 2D gel electrophoresis

    • LC-MS/MS analysis

    • Western blotting with specific antibodies against nuoA

Studies indicate that pathogenic strains may upregulate nuoA expression during specific infection phases, particularly when exposed to host immune factors like nitric oxide, which has been shown to affect respiratory chain function in Y. pseudotuberculosis .

What role does nuoA play in Yersinia pseudotuberculosis virulence and host immune evasion?

While nuoA is primarily a respiratory chain component, emerging research suggests its indirect contribution to virulence through energy metabolism modulation. The protein's function in maintaining bacterial bioenergetics supports several virulence mechanisms:

MechanismRole of nuoAExperimental Evidence
Survival within macrophagesMaintains energy production under oxidative stressDemonstrated in mutant studies showing reduced intracellular survival when respiratory chain components are compromised
Resistance to ROS/RNSContributes to redox balanceVisualization of nitric oxide exposure using fluorescent signals reveals altered responses in respiratory chain mutants
Immune modulationSupports energy needs for toxin productionObserved correlation between metabolic activity and immunomodulatory effects

Research methodologies to investigate this relationship include:

  • Construction of nuoA deletion mutants

  • Macrophage infection assays measuring bacterial survival

  • ROS/RNS resistance testing using specific probes

  • Comparative virulence studies in animal models

Recent findings indicate that targeting respiratory chain components may attenuate bacterial virulence, suggesting potential therapeutic approaches .

How do post-translational modifications affect nuoA function in stress response scenarios?

Post-translational modifications (PTMs) of nuoA appear to regulate its activity under various stress conditions. Research indicates several key modifications:

  • Phosphorylation at conserved serine/threonine residues

  • Potential S-nitrosylation under nitrosative stress

  • Redox-dependent modifications affecting protein-protein interactions

Methodological approaches to investigate PTMs include:

  • Phosphoproteomic analysis using TiO₂ enrichment followed by LC-MS/MS

  • Site-directed mutagenesis of putative modification sites

  • Activity assays comparing wild-type and modified proteins

  • Structural analysis of modified versus unmodified proteins

Studies with Y. pseudotuberculosis exposed to nitric oxide stress have shown altered patterns of respiratory chain protein modifications, suggesting a regulatory mechanism for adaptation to host immune responses . These findings highlight the complex interplay between bacterial metabolism and virulence regulation.

What are the optimal conditions for expressing recombinant nuoA protein from Y. pseudotuberculosis serotype O:1b?

Expression of recombinant nuoA requires careful optimization due to its membrane-associated nature. Recommended expression parameters include:

ParameterOptimal ConditionNotes
Expression systemE. coli BL21(DE3) or specialized membrane protein expression strainsC41(DE3) or C43(DE3) often yield better results for membrane proteins
Induction temperature16-20°CLower temperatures reduce inclusion body formation
Induction agent0.1-0.5 mM IPTGConcentration dependent on expression vector
Growth mediaTB or 2×YT supplemented with 0.4% glucoseRich media supports membrane protein expression
Post-induction time16-20 hoursExtended expression at lower temperatures improves folding

The methodology should include:

  • Codon optimization for the expression host

  • Use of fusion tags (His6, MBP, or SUMO) to improve solubility

  • Addition of membrane-mimicking environments during purification

  • Validation of protein folding using circular dichroism

Researchers have reported successful expression using Tris-based buffers with 50% glycerol as storage buffer, with the purified protein stable at -20°C . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

How can researchers effectively design LAMP primers for detecting Y. pseudotuberculosis strains expressing nuoA?

Loop-mediated isothermal amplification (LAMP) offers advantages for detection of Y. pseudotuberculosis, being more sensitive than conventional PCR . For targeting nuoA specifically:

  • Primer design strategy:

    • Identify conserved regions within the nuoA gene specific to Y. pseudotuberculosis serotype O:1b

    • Design six primers: two outer (F3, B3), two inner (FIP, BIP), and two loop primers

    • Ensure primers target regions with minimal homology to other bacterial species

    • Verify primer specificity using in silico tools

  • Optimization parameters:

    • Reaction temperature: 60-65°C (optimally 63°C)

    • Reaction time: 30 minutes (positive results typically emerge after 15-20 minutes)

    • DNA polymerase: Bst DNA polymerase with strand displacement activity

    • Buffer composition: 20 mM Tris-HCl (pH 8.8), 10 mM KCl, 10 mM (NH₄)₂SO₄, 8 mM MgSO₄

  • Detection methods:

    • Turbidity measurement at 650 nm

    • Fluorescent dyes (SYBR Green I or calcein)

    • Lateral flow dipsticks for field applications

The sensitivity of LAMP can detect as few as 10⁰ CFU of bacteria, making it 100 times more sensitive than PCR for Y. pseudotuberculosis detection . Validation should include testing against non-target Yersinia species and other gram-negative bacteria to confirm specificity.

How can researchers differentiate between nuoA homologs from Y. pseudotuberculosis and other Yersinia species in genomic analyses?

Differentiation of nuoA homologs requires systematic comparative genomics approaches:

  • Sequence alignment methodology:

    • Obtain nuoA sequences from multiple Yersinia species

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Identify signature sequences unique to Y. pseudotuberculosis serotype O:1b

    • Calculate nucleotide and amino acid identity percentages

  • Phylogenetic analysis:

    • Construct maximum-likelihood trees using appropriate evolutionary models

    • Perform bootstrap analysis (1000 replicates) to assess clade confidence

    • Visualize using tools like MEGA, iTOL, or FigTree

  • Identification of diagnostic regions:

    • Focus on regions with >90% conservation within Y. pseudotuberculosis but <80% identity to other species

    • Design PCR primers or probes targeting these diagnostic regions

    • Validate experimentally using reference strain collections

The nuoA gene from Y. pseudotuberculosis serotype O:1b shows distinct sequence patterns compared to Y. pestis (which evolved from Y. pseudotuberculosis O:1b) , despite their close evolutionary relationship. Researchers should pay particular attention to serotype-specific variations, as O-antigen gene clusters in Y. pseudotuberculosis are highly variable and can influence neighboring genetic regions .

What statistical approaches are most appropriate for analyzing nuoA expression data across different environmental conditions?

When analyzing nuoA expression across varied conditions:

  • Experimental design considerations:

    • Include at least 3-5 biological replicates per condition

    • Incorporate appropriate reference genes (validated for stability across tested conditions)

    • Include both technical and biological controls

  • Recommended statistical approaches:

    • For RT-qPCR data: ΔΔCt method with normalization to multiple reference genes

    • For RNA-seq: DESeq2 or edgeR with appropriate dispersion estimation

    • For proteomics: LIMMA or MSstats with correction for batch effects

  • Statistical tests for significance:

    • ANOVA with post-hoc tests for multiple condition comparisons

    • FDR correction for multiple hypothesis testing (Benjamini-Hochberg procedure)

    • Power analysis to ensure adequate sample size

  • Visualization methods:

    • Heatmaps with hierarchical clustering

    • Principal component analysis for multivariate data

    • Box plots with overlay of individual data points

When interpreting results, consider that nuoA expression in Y. pseudotuberculosis often shows complex patterns related to oxygen levels, nitric oxide exposure, and temperature shifts . These environmental factors are particularly relevant when studying host-pathogen interactions, and appropriate statistical methods must account for potential interaction effects between variables.

What purification strategy yields the highest recovery of functional recombinant nuoA protein?

Purification of membrane proteins like nuoA requires specialized approaches:

  • Solubilization strategy:

    • Use mild detergents: n-dodecyl-β-D-maltoside (DDM) at 1% or n-octyl-β-D-glucopyranoside (OG) at 2%

    • Inclusion of stabilizing agents: 10% glycerol, 100 mM NaCl

    • Gradual solubilization at 4°C for 1-2 hours with gentle agitation

  • Chromatography sequence:

    • Initial capture: IMAC using Ni-NTA resin (for His-tagged constructs)

    • Intermediate purification: Ion exchange chromatography

    • Final polishing: Size exclusion chromatography

  • Critical buffer components:

    • Detergent at 2-3× critical micelle concentration

    • Glycerol (10-20%) for stability

    • Reducing agent (1-5 mM DTT or TCEP)

    • Protease inhibitors

  • Activity preservation:

    • Avoid detergent exchange during purification

    • Maintain strict temperature control (4°C throughout)

    • Consider reconstitution into nanodiscs or liposomes for functional studies

For recombinant Y. pseudotuberculosis nuoA, successful purification has been reported using ultrafiltration centrifugation followed by multiple purification steps, with final storage in Tris-based buffer containing 50% glycerol . Activity assays should be performed immediately after purification to establish baseline activity before storage.

How can researchers effectively utilize Y. pseudotuberculosis outer membrane vesicles (OMVs) for delivery of recombinant nuoA protein in immunological studies?

Outer membrane vesicles (OMVs) have emerged as promising delivery vehicles for Yersinia antigens:

  • OMV preparation from Y. pseudotuberculosis:

    • Culture bacteria to mid-logarithmic phase (OD600 0.4-0.6)

    • Add 0.5M EDTA and incubate on ice for 1 hour

    • Remove bacteria by centrifugation (10,000 × g, 15 min, 4°C)

    • Filter supernatant through 0.22-μm filter

    • Concentrate by ultracentrifugation (120,000 × g, 2 h, 4°C)

    • Resuspend pellet in 1/10× PBS

  • Recombinant nuoA incorporation strategies:

    • Genetic approach: Express nuoA in Y. pseudotuberculosis before OMV isolation

    • Chemical approach: Post-isolation loading using detergent destabilization

    • Fusion approach: Create fusions with OMV-targeting sequences

  • Quality control metrics:

    • Particle size determination by nanoparticle tracking analysis

    • Protein content verification by SDS-PAGE and Western blotting

    • Negative staining and transmission electron microscopy (25,000×)

    • Sterility testing through filtration and culture

  • Immunization considerations:

    • Consider using attenuated Y. pseudotuberculosis strains (e.g., ΔlpxL mutants) to reduce toxicity while maintaining immunogenicity

    • Evaluate immune responses through antibody titer measurement and T-cell activation assays

    • Prime-boost regimens often yield superior immune responses compared to single immunizations

Research has demonstrated that Y. pseudotuberculosis OMVs can effectively deliver heterologous antigens and stimulate robust immune responses, including balanced Th1/Th2 responses . When designing experiments, researchers should consider the IgG2a/IgG1 ratio (approximately 1.05 in ΔlpxL mutant OMVs) as an indicator of immune response balance .

How might nuoA be utilized in developing attenuated live vaccines against Y. pestis infection?

Current research demonstrates that attenuated Y. pseudotuberculosis strains show promise as live vaccine platforms:

  • Attenuation strategies involving respiratory components:

    • Targeted mutations in metabolic genes, potentially including nuoA, could create vaccine strains with limited in vivo persistence but maintained immunogenicity

    • Complementation systems using regulated promoters could control expression of essential components for controlled attenuation

  • Methodological considerations:

    • Construction of deletion mutants via allelic exchange

    • Assessment of attenuation through colonization studies in animal models

    • Evaluation of protective immunity through challenge experiments

    • Measurement of specific immune responses to nuoA and other antigens

Recent studies with attenuated Y. pseudotuberculosis (Yptb1) demonstrate that oral prime-boost immunization can provide complete protection against intranasal Y. pestis challenge in mice and substantial protection against aerosolized Y. pestis in rats . The attenuated strain localizes to Peyer's patches, lung, spleen, and liver for weeks after oral immunization without causing disease symptoms . Engineering such strains to express optimized levels of respiratory chain components might further enhance vaccine efficacy.

What role does nuoA play in nitric oxide resistance and how can this be exploited in infection models?

Understanding nuoA's role in nitric oxide (NO) resistance presents valuable research opportunities:

  • Experimental approaches:

    • Utilize fluorescent NO reporters to track exposure at single-cell level

    • Compare wild-type and nuoA mutant strains in NO exposure assays

    • Measure bacterial survival in macrophage infection models with various NO production capacities

    • Analyze gene expression changes in response to NO exposure

  • Methodological details:

    • Culture bacteria to mid-log phase

    • Expose to controlled concentrations of NO donors

    • Use fluorescence microscopy and flow cytometry for single-cell analysis

    • Employ RNA-seq or proteomics to identify co-regulated factors

Research shows that Y. pseudotuberculosis defense against host nitric oxide by the bacterial NO-detoxifying gene hmp promotes replication in mouse infection models . The relationship between respiratory chain components like nuoA and NO detoxification systems represents an underexplored area with implications for understanding host-pathogen interactions and developing intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.