Recombinant Yersinia pseudotuberculosis serotype O:1b NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
nuoK; YpsIP31758_1463; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEVMINAAALAFVVAGSYWGQADGQV MYILAITLAAAEASIGLALLLQLYRRRHTLDIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be ubiquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are moved across the cytoplasmic membrane, thereby conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying NADH-quinone oxidoreductase subunit K in Y. pseudotuberculosis?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the bacterial respiratory chain complex I, which plays an essential role in energy metabolism. In Y. pseudotuberculosis, this protein contributes to bacterial survival under various environmental conditions and potentially influences virulence mechanisms. Research suggests that respiratory chain components may interact with virulence factors, as demonstrated in studies of other Yersinia proteins that affect colonization patterns in host tissues. When examining the colonization patterns of attenuated Y. pseudotuberculosis strains, researchers have observed differential dissemination capabilities in host tissues that may reflect varying metabolic capacities . Understanding nuoK function provides insights into bacterial bioenergetics and potential targets for therapeutic intervention.

How does Y. pseudotuberculosis serotype O:1b differ from other Yersinia species in terms of genetic manipulation?

Y. pseudotuberculosis serotype O:1b presents unique characteristics compared to other Yersinia species, particularly in terms of genetic manipulation approaches. While Y. pseudotuberculosis and Y. pestis share significant genetic similarity (over 97% sequence identity in some proteins) , serotype-specific differences influence experimental approaches. When developing recombinant systems, researchers should note that genetic manipulation techniques established for Y. pseudotuberculosis often employ suicide vectors conferring resistance to antibiotics and sensitivity to sucrose, similar to the pCVD442 system used for mutant generation . Triple mutation approaches (such as Δasd ΔyopK ΔyopJ) have been successfully applied to Y. pseudotuberculosis, suggesting similar strategies could be employed for nuoK manipulation . The genomic context of nuoK should be considered, as Y. pseudotuberculosis strains may contain strain-specific regions with unique insertion element patterns that differ from other Yersinia species .

What expression systems are most effective for recombinant nuoK production?

For optimal expression of recombinant Y. pseudotuberculosis nuoK, several expression systems have demonstrated effectiveness in Yersinia research. Based on successful expression of other Yersinia proteins:

Expression SystemAdvantagesLimitationsApplication for nuoK
E. coli SM10 λpirHigh yield, well-established protocolsMay lack post-translational modificationsInitial protein characterization
L. lactis MG1363Secretion capacity, useful for immunization studiesLower yield than E. coliStudies involving protein delivery
Y. pseudotuberculosis (self-expression)Native modifications, physiological relevanceMore challenging genetic manipulationFunctional studies in native context

For nuoK expression, the pNZYR vector system with chloramphenicol selection (10 μg/ml) has shown effectiveness for other Yersinia proteins when translationally fused with secretion signal sequences . For chromosomal manipulation of nuoK, the allelic exchange approach after mating has been successfully implemented for other Y. pseudotuberculosis genes . Expression conditions typically involve culturing Y. pseudotuberculosis in lysogeny broth at 28°C, E. coli at 37°C, or L. lactis in M17 medium supplemented with 0.5% glucose at 30°C .

How might nuoK contribute to Y. pseudotuberculosis virulence and host colonization patterns?

The contribution of nuoK to Y. pseudotuberculosis virulence likely involves its role in energy metabolism and potential interactions with established virulence mechanisms. Research on Y. pseudotuberculosis colonization patterns shows that wild-type strains effectively colonize spleens and livers with bacterial numbers steadily growing at 3, 6, and 9 days post-infection . In contrast, attenuated strains show differential dissemination patterns, with reduced bacterial loads in tissues over time.

For nuoK specifically, researchers should investigate its potential connections to:

  • The ability of Y. pseudotuberculosis to disseminate to different organs (liver, spleen, lungs) following infection

  • Bacterial persistence in tissues at different time points post-infection

  • Interactions with known virulence factors like the Yersinia Type III Secretion System (T3SS)

Experimental infection models similar to those used with other Y. pseudotuberculosis strains could reveal whether nuoK mutations affect organ colonization patterns, particularly the rapid dissemination into livers observed at 3 days post-infection with some strains and the gradual decline in bacterial numbers in spleens at 6 and 9 days post-infection .

What computational approaches can identify functional domains within nuoK for targeted mutagenesis?

Effective computational analysis of nuoK should employ multiple bioinformatic strategies:

  • Whole genome alignment approaches utilizing the HOXD scoring system, which has proven effective for Yersinia genomic analysis

  • Average Nucleotide Identity (ANI) comparisons to identify conserved regions across Yersinia species

  • Neighbor Joining (NJ) phylogenetic analysis to understand evolutionary relationships of nuoK across species

When designing mutagenesis experiments, researchers should consider:

  • Identifying transmembrane domains that are critical for nuoK integration into the respiratory complex

  • Locating highly conserved residues across Yersinia species that may indicate functional importance

  • Mapping potential interaction sites with other respiratory complex components

Bioinformatic analysis similar to that performed for other Yersinia genes revealed that different strains can share variable percentages of sequence coverage, suggesting that targeted mutagenesis approaches should account for strain-specific nuoK variations .

How does nuoK expression change under different environmental conditions relevant to infection?

The expression profile of nuoK likely varies under different environmental conditions that Y. pseudotuberculosis encounters during infection. Based on studies of Yersinia colonization patterns:

Environmental ConditionExpected nuoK Expression PatternBiological Relevance
Gastrointestinal tract (early infection)Potentially upregulated to support energy needs during initial colonizationMay correlate with bacterial presence in Peyer's patches
Dissemination to liver/spleenExpression patterns may change to adapt to new tissue environmentMay influence colonization efficiency observed in liver/spleen at 3-9 days post-infection
Nutrient limitationLikely critical for maintaining energy production under stressMay contribute to persistence in tissues over time
Immune response exposureMay be regulated in response to host defense mechanismsCould influence bacterial survival during extended infection

To investigate these patterns, researchers should employ transcriptomic approaches (RNA-Seq or qRT-PCR) to measure nuoK expression under conditions mimicking different infection stages, similar to methodologies used for other Yersinia virulence factors .

What are the key considerations when designing a knockout strategy for nuoK in Y. pseudotuberculosis?

When designing a knockout strategy for nuoK in Y. pseudotuberculosis, researchers should consider several critical factors:

  • Selection of genetic engineering approach:

    • Allelic exchange systems have been successfully used for Y. pseudotuberculosis gene manipulation

    • pCVD442 suicide vector conferring resistance to ampicillin (100 μg/ml) and sensitivity to sucrose has proven effective

    • Triple mutation approaches (e.g., Δasd ΔyopK ΔyopJ) demonstrate the feasibility of creating multiple mutations

  • Verification of knockout:

    • PCR verification of gene deletion

    • RT-PCR to confirm absence of transcript

    • Proteomic analysis to verify protein absence

    • Phenotypic characterization including growth curves in different media

  • Complementation strategy:

    • Design plasmid-based complementation using vectors like pYA5199, which has been used for complementation in Y. pseudotuberculosis

    • Consider chromosomal reinsertion to maintain physiological expression levels

  • Experimental controls:

    • Include wild-type strain

    • Use isogenic mutants with established phenotypes as reference points

    • Include empty vector controls for complementation studies

When implementing the knockout, researchers should assess respiratory function, growth characteristics, and virulence properties to fully characterize the nuoK mutant phenotype, as demonstrated in studies of other Y. pseudotuberculosis mutants .

What animal models are most appropriate for studying the impact of nuoK on Y. pseudotuberculosis pathogenesis?

For investigating the role of nuoK in Y. pseudotuberculosis pathogenesis, several animal models have demonstrated effectiveness:

Animal ModelAdvantagesKey Parameters to MonitorRelevance to nuoK
Swiss Webster miceEstablished model for Y. pseudotuberculosis infectionBacterial colonization in tissues, survival ratesSuitable for assessing systemic infection
Intravenous challenge modelDirect assessment of systemic disseminationLiver/spleen bacterial loads, survival curvesAppropriate for studying nuoK's role in energy metabolism during systemic spread
Intranasal challenge modelMimics respiratory infection routeLung colonization, dissemination patternsUseful for studying nuoK's role during respiratory transmission
Oral infection modelMost physiologically relevant for Y. pseudotuberculosisGastrointestinal colonization, Peyer's patch infectionIdeal for studying nuoK's role during natural infection route

Based on previous Y. pseudotuberculosis research, bacterial loads should be monitored in multiple organs (liver, spleen, lungs) at several time points (3, 6, and 9 days post-infection) to capture the dynamics of infection . Statistical analysis should employ appropriate tests such as the Mann-Whitney U test for comparing bacterial loads and the log-rank test for survival curve analysis .

What techniques can effectively measure nuoK enzymatic activity in different experimental contexts?

To accurately assess nuoK enzymatic activity as part of the NADH-quinone oxidoreductase complex:

  • Membrane fraction preparation:

    • Isolate bacterial membranes using differential centrifugation

    • Prepare inside-out membrane vesicles to access the cytoplasmic face of the complex

  • Activity assays:

    • NADH:ubiquinone oxidoreductase activity measurement using spectrophotometric methods

    • Oxygen consumption rates using a Clark-type electrode

    • Proton pumping efficiency using pH-sensitive fluorescent dyes

  • In vivo measurements:

    • Membrane potential assessment using fluorescent probes

    • ATP production quantification

    • Growth yield calculations under different carbon sources

  • Data analysis approach:

    • Compare enzyme kinetics parameters (Km, Vmax) between wild-type and mutant strains

    • Analyze initial reaction rates under varying substrate concentrations

    • Assess inhibitor sensitivity profiles

Researchers should correlate enzymatic activity with phenotypic characteristics such as growth rates, virulence properties, and colonization abilities to establish the functional significance of nuoK in Y. pseudotuberculosis pathogenesis, similar to approaches used for characterizing other bacterial respiratory components.

How should researchers interpret conflicting colonization data when studying nuoK mutants?

When confronted with conflicting colonization data for nuoK mutants, researchers should implement a systematic analysis approach:

  • Context-dependent analysis:

    • Compare colonization patterns across different tissues (liver, spleen, lungs)

    • Analyze temporal dynamics (early vs. late infection)

    • Assess variation between individual animals

Previous Y. pseudotuberculosis research has revealed complex colonization patterns that vary by tissue and time point. For instance, bacterial dissemination to livers may occur rapidly (by 3 days post-infection) while detectable colonization in lungs may be delayed until 6 days post-infection . For nuoK mutants, researchers should examine whether:

  • Colonization defects are tissue-specific

  • Temporal dynamics differ from wild-type patterns

  • Initial colonization occurs normally but persistence is affected

By implementing this multi-faceted analysis approach, researchers can resolve apparently conflicting data and develop a more nuanced understanding of nuoK's role in Y. pseudotuberculosis pathogenesis.

What genomic analysis approaches can identify functional conservation of nuoK across Yersinia species?

To assess functional conservation of nuoK across Yersinia species, researchers should employ multi-layered genomic analysis:

  • Comparative genomic approaches:

    • Whole Genome Alignment using algorithms like the HOXD scoring system

    • Average Nucleotide Identity (ANI) comparisons to quantify similarity percentages

    • Neighbor Joining phylogenetic analysis to establish evolutionary relationships

  • Gene context analysis:

    • Examine synteny of nuoK and surrounding genes across species

    • Identify conserved operonic structures

    • Assess potential horizontal gene transfer events

  • Specific analytical tools:

    • EnteroBase-based analysis for Y. enterocolitica biotype comparisons

    • Core genome MLST (cgMLST) and whole-genome MLST (wgMLST) approaches

    • SNP-based phylogenetic analysis using maximum-likelihood trees with appropriate substitution models (e.g., TVMe+ASC+R3)

Research on Yersinia genomes has revealed significant heterogeneity, with Y. enterocolitica strains showing more than 14% strain-specific genes . This suggests nuoK may also show species-specific and strain-specific variations that could be functionally significant. Researchers should identify conserved regions that likely represent critical functional domains versus variable regions that may reflect adaptation to specific environmental niches.

How can transcriptomic and proteomic data be integrated to understand nuoK regulation?

Effective integration of transcriptomic and proteomic data for understanding nuoK regulation requires:

  • Experimental design considerations:

    • Synchronize sampling conditions between transcriptomic and proteomic experiments

    • Include multiple time points to capture dynamic regulation

    • Compare multiple environmental conditions relevant to infection stages

  • Data integration methodology:

    • Correlate nuoK transcript abundance with protein levels

    • Identify potential post-transcriptional regulation mechanisms

    • Map regulatory networks affecting nuoK expression

  • Analytical framework:

    • Apply pathway enrichment analysis to identify co-regulated processes

    • Construct protein-protein interaction networks centered on nuoK

    • Employ systems biology approaches to model regulatory circuits

Analysis LevelKey MetricsBiological Interpretation
Transcript abundanceRPKM/FPKM values, differential expressionTranscriptional regulation mechanisms
Protein abundanceSpectral counts, intensity valuesTranslation efficiency, protein stability
Post-translational modificationsPhosphorylation, acetylation sitesFunctional regulation mechanisms
Protein-protein interactionsCo-immunoprecipitation data, bacterial two-hybridRespiratory complex assembly, functional interactions

By integrating these multi-omics datasets, researchers can develop comprehensive models of nuoK regulation that account for transcriptional control, post-transcriptional mechanisms, and functional interactions within respiratory complexes, similar to approaches used for other bacterial respiratory components.

What is the potential of targeting nuoK in vaccine development against Y. pseudotuberculosis?

The potential of nuoK as a vaccine target must be evaluated in the context of established Y. pseudotuberculosis vaccine approaches:

  • Attenuated live vaccine considerations:

    • nuoK mutation could be incorporated into attenuated vaccine strains to enhance safety

    • Combination with established attenuations (e.g., ΔyopK ΔyopJ Δasd triple mutations) should be evaluated

    • Energy metabolism attenuation through nuoK modification might balance virulence reduction with immunogenicity

  • Potential delivery systems:

    • Recombinant attenuated Y. pseudotuberculosis strains like χ10069 have demonstrated effectiveness in delivering protective antigens

    • L. lactis expression systems have been used successfully for Yersinia antigen delivery

    • Plasmid systems such as pYA5199 could potentially incorporate nuoK-derived antigens

  • Immune response considerations:

    • Both systemic and mucosal immunity are important for protection against Yersinia infection

    • Monitoring of antibody titers using techniques like Mann-Whitney U test for statistical analysis

    • Vaccine efficacy assessment through challenge studies and survival curve analysis using log-rank test

How can sequence polymorphisms in nuoK be assessed for impact on cross-protection?

Analysis of sequence polymorphisms in nuoK requires methodical approaches to assess their impact on cross-protection:

  • Polymorphism identification strategy:

    • Genome sequencing of multiple Y. pseudotuberculosis isolates

    • Comparative analysis with other Yersinia species

    • Identification of variable regions versus conserved domains

  • Functional impact assessment:

    • Site-directed mutagenesis to introduce specific polymorphisms

    • Enzymatic activity measurements of variant proteins

    • Structural modeling to predict impact on protein function

  • Immunological relevance evaluation:

    • Epitope mapping of nuoK variants

    • Assessment of antibody binding to polymorphic regions

    • T-cell response characterization

Research on Yersinia antigens has demonstrated that subtle substitutions can significantly impact cross-protection. For example, studies with the LcrV antigen revealed that mice immunized with Y. pseudotuberculosis LcrV were protected against pseudotuberculosis but not against plague, despite >97% sequence identity between the proteins . This precedent suggests that even minor polymorphisms in nuoK could potentially affect cross-protection.

Experiments should include vaccination with different nuoK variants followed by challenge with various Yersinia strains, with survival rates compared using appropriate statistical methods such as the log-rank test . Such studies would reveal whether nuoK polymorphisms represent a potential barrier to broad-spectrum vaccine development.

What strategies can address challenges in expressing and purifying functional recombinant nuoK?

Membrane proteins like nuoK present significant challenges for recombinant expression and purification. Researchers should consider:

  • Expression system optimization:

    • Test multiple host systems (E. coli, L. lactis, Y. pseudotuberculosis)

    • Evaluate different promoter strengths and induction conditions

    • Consider fusion partners to enhance solubility

  • Membrane protein-specific approaches:

    • Detergent screening for optimal solubilization

    • Amphipol or nanodisc reconstitution for maintaining native conformation

    • Directed evolution of expression hosts for improved membrane protein yield

  • Purification strategy refinement:

    • Test multiple affinity tags and their positioning (N-terminal vs. C-terminal)

    • Implement two-step chromatography for higher purity

    • Optimize buffer conditions to maintain protein stability

  • Functional verification methods:

    • In vitro activity assays under varying detergent/lipid conditions

    • Structural integrity assessment by circular dichroism

    • Reconstitution into liposomes for functional studies

For each approach, researchers should implement systematic optimization and carefully document conditions that improve yield and activity, similar to methodologies used for other challenging Yersinia membrane proteins.

How can researchers troubleshoot inconsistent phenotypes in nuoK mutant studies?

When confronted with inconsistent phenotypes in nuoK mutant studies, researchers should implement a systematic troubleshooting approach:

  • Genetic verification:

    • Confirm gene deletion by PCR and sequencing

    • Verify absence of expression by RT-PCR and Western blotting

    • Check for secondary mutations or compensatory changes

    • Sequence the entire genome to identify potential suppressor mutations

  • Experimental condition standardization:

    • Control for growth phase effects on phenotype (early vs. late log phase)

    • Standardize media composition and growth conditions

    • Establish consistent animal infection protocols

    • Control for host factors in animal studies

  • Statistical approaches:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests (Mann-Whitney U test for non-parametric data)

    • Implement power analysis to determine adequate sample sizes

  • Positive controls:

    • Include known Y. pseudotuberculosis mutants with established phenotypes

    • Use defined conditions that produce consistent results with wild-type strains

Studies of Y. pseudotuberculosis colonization have shown that bacterial distribution can vary significantly between organs and time points . For nuoK mutants, researchers should carefully control for these variables and consider whether inconsistent phenotypes might reflect genuine biological complexity rather than experimental error.

Through methodical troubleshooting and the implementation of appropriate controls, researchers can develop a more nuanced understanding of nuoK function that accounts for context-dependent effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.