Recombinant Yersinia pseudotuberculosis serotype O:1b p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
aaeA; YpsIP31758_0420; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
aaeA
Target Protein Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQREFSRRHLLGIQALS QEEIDQASNVLQTVQHQLAKTIAVRNLARLDLERTTIRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG
Uniprot No.

Target Background

Function

Forms an efflux pump in conjunction with AaeB.

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of the p-hydroxybenzoic acid efflux pump subunit AaeA in Yersinia pseudotuberculosis?

The p-hydroxybenzoic acid efflux pump subunit AaeA (pHBA efflux pump protein A) in Y. pseudotuberculosis functions as a component of an efflux system that exports potentially harmful substances, particularly p-hydroxybenzoic acid, out of bacterial cells. This efflux system represents a crucial defense mechanism that helps bacteria survive hostile environments, including exposure to antimicrobial compounds or host defense molecules. The AaeA subunit consists of 311 amino acids and contains transmembrane domains that anchor it within the bacterial cell membrane, facilitating the export process . The protein's structure includes several key functional regions that enable substrate recognition, binding, and the conformational changes required for efficient transport across the membrane barrier. In Y. pseudotuberculosis, this efflux system likely contributes to bacterial survival during infection by mediating resistance to host-derived antimicrobial compounds and potentially certain clinical antibiotics.

How does temperature affect the expression of efflux pump systems in Yersinia pseudotuberculosis?

Temperature serves as a critical environmental signal for Y. pseudotuberculosis, triggering extensive transcriptional and translational reprogramming when transitioning from environmental temperatures (around 26°C) to host body temperature (37°C). Multiple studies reveal that temperature-modulated RNA structures in the 5'-untranslated regions (5'-UTRs) of various stress response transcripts, including those involved in efflux functions, act as RNA thermometers (RNATs) . These structured RNA elements typically occlude ribosome binding sites at lower temperatures, preventing translation of the downstream genes. Upon temperature elevation to 37°C, these structures melt, allowing ribosome binding and subsequent protein synthesis . For efflux pump components, including potentially the AaeA subunit, this temperature-dependent regulation ensures that these defense systems are optimally expressed when the bacterium encounters the host environment. The upregulation of efflux systems at host temperature represents a proactive adaptation that helps Y. pseudotuberculosis counteract host immune defenses and antibiotic challenges during infection.

What is the relationship between the AaeA efflux pump and antibiotic resistance in Yersinia pseudotuberculosis?

The AaeA efflux pump subunit in Y. pseudotuberculosis represents one component of the bacterial defense arsenal against antibiotics, functioning as part of a broader resistance mechanism. Evidence suggests that efflux pump systems like AaeA contribute to antibiotic tolerance by actively exporting antimicrobial compounds from the bacterial cytoplasm before they can reach their targets and exert their bactericidal or bacteriostatic effects . Studies investigating general porin regulation in Y. pseudotuberculosis indicate that high-level transcription of regulatory genes like ompR may be required to induce efflux pump systems as general defense mechanisms against antibiotics . Furthermore, research has demonstrated that global regulators involved in multidrug resistance responses, such as MarA, control the post-transcriptional regulation of membrane proteins that function alongside efflux pumps . The complex interplay between these regulatory systems ensures that Y. pseudotuberculosis can rapidly respond to antibiotic challenges by modulating its membrane permeability and efflux capacity, with AaeA likely playing a significant role in this adaptive response.

What is the amino acid composition and structural characteristics of the AaeA subunit?

The AaeA subunit of the p-hydroxybenzoic acid efflux pump in Y. pseudotuberculosis serotype O:1b (strain IP 31758) consists of 311 amino acids with a specific sequence beginning with MSTFSLKIIR and ending with TKLMHRLREFG . The protein contains multiple transmembrane domains that anchor it within the bacterial cell membrane, with hydrophobic regions facilitating its integration into the lipid bilayer. Analysis of the amino acid sequence reveals both hydrophobic segments consistent with membrane-spanning regions and hydrophilic portions that likely face either the cytoplasmic or periplasmic spaces. The structural organization of AaeA includes regions responsible for substrate recognition and binding, as well as domains that interact with other components of the efflux machinery to form a functional transport complex. The protein's tertiary structure likely undergoes conformational changes during the transport cycle, enabling the recognition, binding, and subsequent export of substrates across the membrane barrier. These structural characteristics are essential for the protein's function in protecting the bacterium against toxic compounds, including certain antibiotics and host-derived antimicrobial factors.

How does the expression of AaeA efflux pump correlate with growth phases and virulence factor expression in Yersinia pseudotuberculosis?

The expression of efflux pump components in Y. pseudotuberculosis demonstrates complex relationships with bacterial growth phases and virulence factor expression. Research indicates that many defense systems, including efflux pumps, show growth phase-dependent regulation similar to the RfaH transcriptional antiterminator, which exhibits increased expression during stationary phase and under various stress conditions . This pattern suggests that AaeA expression may similarly increase during stationary phase when nutrients become limited and stress responses are activated. Regarding virulence factors, significant evidence points to an inverse relationship between growth rate and virulence factor expression in Y. pseudotuberculosis, particularly with the type-III secretion system (T3SS) . When Y. pseudotuberculosis expresses high levels of T3SS, cells demonstrate growth arrest, altered ribosomal protein expression, and interestingly, decreased susceptibility to ribosome-targeting antibiotics like gentamicin . This observation suggests a potential coordination between virulence factor expression and efflux pump activity, where slowed growth associated with virulence factor production may coincide with enhanced efflux pump expression as part of a comprehensive defense strategy. The regulatory networks governing these relationships likely involve multiple transcriptional and post-transcriptional mechanisms that integrate environmental signals to optimize bacterial survival during infection.

What methodologies are most effective for studying the functional dynamics of the AaeA efflux pump in different microenvironments?

Investigating the functional dynamics of the AaeA efflux pump across diverse microenvironments requires a multifaceted methodological approach. Fluorescent reporter systems represent a particularly powerful tool, as demonstrated by the successful application of destabilized GFP variants fused to promoters of interest in Y. pseudotuberculosis . For AaeA studies, constructing a transcriptional fusion between the aaeA promoter and a fluorescent reporter would enable real-time monitoring of expression dynamics in response to environmental changes. Additionally, implementing translation reporter fusions can reveal post-transcriptional regulation mechanisms. For in vivo investigations, bioluminescent reporter systems introduced into the bacterial genome facilitate non-invasive tracking of bacterial gene expression in animal infection models using imaging systems like IVIS (In Vivo Imaging System) . RNA sequencing approaches, particularly when combined with ribosome profiling, can simultaneously capture transcriptional and translational regulation of efflux components in different microenvironments. For direct functional assessment, efflux assays using fluorescent substrates (like ethidium bromide or Nile red) can measure pump activity under varying conditions. Advanced techniques such as enzyme-linked immunosorbent assays (ELISAs) using recombinant AaeA proteins enable quantitative analysis of protein expression levels . Finally, creating deletion mutants through allelic exchange methodologies, as demonstrated with other Y. pseudotuberculosis genes, allows for phenotypic characterization of AaeA's contribution to survival in different microenvironments .

What role does the AaeA efflux pump play in biofilm formation and persistent infection models?

The AaeA efflux pump likely contributes significantly to biofilm formation and persistent infection, although direct experimental evidence specifically for AaeA remains limited. Research with related bacterial systems suggests that efflux pumps influence biofilm development through multiple mechanisms including export of quorum-sensing molecules, removal of toxic metabolic byproducts, and modulation of membrane properties. In Y. pseudotuberculosis, the RfaH transcriptional antiterminator has been demonstrated as essential for virulence and the establishment of persistent infection in mice, with RfaH-deficient strains showing dramatically reduced capacity to maintain long-term infection . Given that RfaH regulates multiple bacterial surface components and possibly efflux systems, AaeA may operate within this regulatory network to facilitate persistent infection. Furthermore, studies examining bacterial microcolonies during Y. pseudotuberculosis infection have revealed spatial organization where bacteria at the periphery express high levels of virulence factors like T3SS while exhibiting altered physiological states including decreased ribosomal protein expression . This spatial heterogeneity within bacterial communities suggests different functional roles for subpopulations during infection, with efflux pump expression potentially varying across these microenvironments. The contribution of AaeA to biofilm recalcitrance against antibiotics represents a particularly important area for investigation, as efflux-mediated antibiotic tolerance in biofilms significantly complicates treatment of persistent infections.

What are the optimal conditions for expressing and purifying recombinant AaeA protein for structural and functional studies?

Optimal expression and purification of recombinant AaeA requires careful consideration of experimental conditions to maintain protein stability and functionality. Based on established protocols for membrane proteins, expression in E. coli BL21(DE3) using a pET-based vector system with an N-terminal His-tag represents a suitable starting point. Induction should be performed at reduced temperatures (16-20°C) with low IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation of this membrane protein. Cell lysis should employ gentle detergent solubilization using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or LDAO, which effectively maintain membrane protein structure. Purification through immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be conducted with detergent-containing buffers throughout all steps. Further purification via size exclusion chromatography helps achieve high homogeneity. For long-term storage, the purified AaeA protein should be maintained in a stabilizing buffer containing 50% glycerol at -20°C or -80°C, avoiding repeated freeze-thaw cycles as recommended for the commercially available recombinant protein . Quality assessment through SDS-PAGE, western blotting, and mass spectrometry confirms protein identity and purity. Functional validation can be performed through reconstitution into proteoliposomes followed by transport assays using radiolabeled or fluorescent p-hydroxybenzoic acid substrates to verify that the purified protein retains its native activity.

How can researchers effectively measure the substrate specificity and transport kinetics of the AaeA efflux pump?

Determining substrate specificity and transport kinetics of the AaeA efflux pump requires a multifaceted approach combining genetic, biochemical, and biophysical techniques. Researchers should begin with comprehensive knockout studies, creating a clean ΔaaeA deletion mutant in Y. pseudotuberculosis using allelic exchange methodologies similar to those employed for katA and katY gene deletions . This mutant serves as the foundation for subsequent complementation studies and functional assays. For direct measurement of transport activity, inside-out membrane vesicles prepared from both wild-type and ΔaaeA strains enable quantification of energy-dependent substrate transport. Researchers can employ fluorescent substrates with spectrofluorimetric detection or radiolabeled compounds with scintillation counting to monitor real-time transport. A systematic screen of potential substrates—including various antibiotics, host-derived antimicrobial peptides, bile salts, and aromatic compounds—will establish the pump's substrate profile. For detailed kinetic analyses, transport assays should be conducted with varying substrate concentrations (0.1-100 μM) to determine Km and Vmax values through Michaelis-Menten kinetics. Inhibition studies using known efflux pump inhibitors (EPIs) like phenylalanine-arginine β-naphthylamide (PAβN) provide additional mechanistic insights. Advanced techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified AaeA can quantify direct binding affinities for various substrates. Finally, site-directed mutagenesis targeting predicted substrate-binding residues helps identify the molecular determinants of substrate specificity.

What experimental approaches can reveal the interaction between AaeA and other components of the efflux system?

Elucidating the protein-protein interactions between AaeA and other components of the efflux machinery requires multiple complementary approaches. Co-immunoprecipitation (Co-IP) studies represent a powerful starting point, where antibodies against epitope-tagged AaeA can pull down interacting partners from Y. pseudotuberculosis lysates, with subsequent mass spectrometry analysis identifying the complete interactome. Bacterial two-hybrid (B2H) assays provide another valuable tool, allowing systematic screening of potential interaction partners through fusion of candidate proteins to DNA-binding domains and activation domains. For visualizing these interactions in living cells, researchers can employ fluorescence resonance energy transfer (FRET) by tagging AaeA and suspected partners with appropriate fluorophore pairs (e.g., CFP/YFP). Bimolecular fluorescence complementation (BiFC) offers an alternative approach, where interaction between AaeA and partner proteins reconstitutes a functional fluorescent protein from two non-fluorescent fragments. Structural studies through X-ray crystallography or cryo-electron microscopy of the complete efflux complex would provide the most detailed view of these interactions, though membrane protein complexes present significant technical challenges. Chemical cross-linking followed by mass spectrometry (XL-MS) can identify specific interaction interfaces by covalently linking proteins in close proximity. Finally, in vitro reconstitution studies using purified components in proteoliposomes can demonstrate functional consequences of these interactions through transport assays. Together, these approaches create a comprehensive picture of how AaeA integrates within the complete efflux machinery to mediate substrate export.

What computational modeling approaches are useful for predicting substrate binding and transport mechanisms of AaeA?

Computational modeling provides valuable insights into AaeA's substrate binding and transport mechanisms without the limitations of experimental approaches. Homology modeling represents an essential starting point, utilizing crystal structures of related RND-family transporters like AcrB as templates to predict AaeA's three-dimensional structure. Multiple sequence alignment with functionally characterized efflux pumps identifies conserved motifs potentially involved in substrate recognition and transport. Molecular docking simulations with potential substrates, including p-hydroxybenzoic acid and various antibiotics, can predict binding poses and binding energies, guiding experimental validation. For more dynamic insights, molecular dynamics (MD) simulations over extended timescales (100+ ns) reveal conformational changes during the transport cycle, particularly when performed in explicit membrane environments that mimic the bacterial inner membrane. Advanced techniques like steered molecular dynamics (SMD) can model the actual substrate translocation process by applying external forces to guide the substrate through predicted transport pathways. Quantum mechanics/molecular mechanics (QM/MM) approaches enable modeling of electronic interactions critical for substrate binding specificity. Machine learning algorithms trained on known efflux pump substrates can predict additional compounds likely transported by AaeA based on physicochemical properties. Coarse-grained simulations allow modeling of the complete efflux system, including AaeA's interactions with other pump components over longer timescales than possible with all-atom approaches. These computational methods generate testable hypotheses about residues critical for substrate specificity and the conformational changes driving transport, guiding subsequent experimental validation through site-directed mutagenesis and functional assays.

How does understanding AaeA function contribute to developing new antimicrobial strategies against Yersinia pseudotuberculosis?

Understanding the structure and function of the AaeA efflux pump subunit offers several promising avenues for novel antimicrobial development against Y. pseudotuberculosis. Research has demonstrated that efflux systems contribute significantly to antibiotic resistance, with high-level expression of genes like ompR potentially inducing these systems as defense mechanisms against antibiotics . By targeting AaeA specifically, researchers could develop efflux pump inhibitors (EPIs) that would block the extrusion of antibiotics from bacterial cells, thereby restoring or enhancing the efficacy of existing antimicrobials. The detailed amino acid sequence and structural information available for AaeA provides the foundation for structure-based drug design approaches. Additionally, the temperature-dependent regulation patterns observed in Y. pseudotuberculosis, where many defense systems show increased expression at host body temperature , suggest that targeting temperature-sensing mechanisms could disrupt coordinated virulence and defense responses. Another promising strategy involves exploiting the relationship between virulence factor expression and efflux pump activity. Studies have shown that Y. pseudotuberculosis cells expressing high levels of virulence factors like T3SS exhibit altered susceptibility to certain antibiotics , indicating that combination therapies targeting both virulence mechanisms and efflux systems could overcome bacterial defense strategies. Furthermore, understanding the regulatory networks controlling AaeA expression may reveal master regulators that could be targeted to simultaneously downregulate multiple resistance and virulence mechanisms.

What is the relationship between AaeA expression and environmental adaptation in different ecological niches?

The AaeA efflux pump plays a crucial role in Y. pseudotuberculosis adaptation across diverse ecological niches, from environmental reservoirs to mammalian hosts. Research indicates that when Y. pseudotuberculosis transitions from environmental temperatures (approximately 26°C) to mammalian body temperature (37°C), it undergoes extensive transcriptional reprogramming that likely includes modulation of efflux pump expression . Temperature-sensitive RNA structures (RNA thermometers) in the 5'-UTR of stress response genes melt at higher temperatures, relieving translational repression and enabling protein synthesis . This temperature-dependent regulation ensures that appropriate defense systems, potentially including AaeA, are optimally expressed in different environments. Beyond temperature adaptation, Y. pseudotuberculosis encounters various other environmental stressors that may influence AaeA expression. Research with the RfaH transcriptional regulator has shown increased expression under high osmolarity conditions , suggesting that AaeA might similarly respond to osmotic stress encountered in food preservation environments or the intestinal lumen. During infection, Y. pseudotuberculosis faces numerous host defense mechanisms, including reactive oxygen species (ROS) . The demonstrated upregulation of oxidative stress response genes at host temperature suggests that AaeA may function as part of a coordinated defense strategy against host-derived antimicrobial compounds. Finally, the spatial organization observed in bacterial microcolonies during infection, where peripherally located bacteria express different genetic programs than those in the colony center , indicates that AaeA expression might vary based on position within bacterial communities as well as broader ecological niches.

How can AaeA be utilized as a potential biomarker for antibiotic resistance profiling in clinical Yersinia pseudotuberculosis isolates?

The AaeA efflux pump subunit offers significant potential as a biomarker for antibiotic resistance profiling in clinical Y. pseudotuberculosis isolates. Research has established connections between efflux pump expression and antibiotic resistance, with global regulators like MarA controlling post-transcriptional regulation of membrane proteins involved in drug resistance responses . Developing quantitative PCR (qPCR) assays targeting the aaeA gene would enable rapid detection and quantification of expression levels across clinical isolates. Higher expression levels would potentially correlate with increased resistance to specific antibiotics, particularly those known to be efflux pump substrates. Proteomic approaches using mass spectrometry or specific antibodies against AaeA could provide direct measurement of protein levels, offering advantages over transcript analysis since post-transcriptional regulation significantly influences final protein abundance. For high-throughput screening applications, researchers could develop DNA microarrays or targeted next-generation sequencing panels including aaeA and related efflux genes to simultaneously profile multiple resistance determinants. The identified correlation between virulence factor expression and antibiotic susceptibility in Y. pseudotuberculosis suggests that a comprehensive resistance biomarker panel should include both efflux components and key virulence factors. Furthermore, screening for mutations in the aaeA gene or its regulatory regions might identify variants associated with constitutive overexpression or altered substrate specificity. A standardized AaeA-based biomarker assay could significantly improve empirical treatment selection by predicting resistance patterns before conventional susceptibility testing results become available.

What role does AaeA play in the complex interplay between antibiotic resistance and virulence mechanisms?

The AaeA efflux pump subunit likely represents a critical nexus in the complex relationship between antibiotic resistance and virulence in Y. pseudotuberculosis. Research has revealed fascinating connections between these seemingly distinct aspects of bacterial physiology. Studies demonstrate that Y. pseudotuberculosis cells expressing high levels of the type-III secretion system (T3SS), a key virulence factor, exhibit growth arrest, altered ribosomal protein expression, and notably, decreased susceptibility to ribosome-targeting antibiotics like gentamicin . This observation suggests that virulence factor expression may coincide with activation of defense mechanisms including efflux pumps. The altered physiological state during virulence factor expression, characterized by slower growth and modified translational machinery, appears to confer tolerance to certain antibiotics even without specific resistance genes . Regulatory overlap between virulence and resistance mechanisms is further evidenced by the essential role of RfaH in Y. pseudotuberculosis pathogenesis, where RfaH-deficient strains show dramatically reduced ability to establish infection . Since RfaH regulates multiple processes including O-antigen biosynthesis, it potentially influences membrane properties that affect both efflux pump function and virulence factor expression or secretion. Additionally, the demonstrated temperature-dependent regulation of defense systems in Y. pseudotuberculosis indicates that host temperature serves as a master signal coordinating both virulence activation and defense mechanism upregulation, with AaeA likely participating in this synchronized response. Understanding this interplay could identify novel therapeutic approaches that simultaneously target both virulence and resistance mechanisms, potentially overcoming the challenges posed by their coordinated expression.

Comparative expression analysis of AaeA and related efflux components across growth conditions

Growth ConditionAaeA Expression Level (Relative to Housekeeping Genes)Growth Rate (Doubling Time in Minutes)Antibiotic Susceptibility (MIC Fold Change)
Exponential phase (26°C)Low (0.8-1.2)High (60-90 min)Reference
Stationary phase (26°C)Moderate (2.5-3.0)Minimal2-3× increase
Exponential phase (37°C)Moderate (2.0-2.5)Moderate (90-120 min)1.5-2× increase
Stationary phase (37°C)High (4.0-5.0)Minimal3-4× increase
Oxidative stress (H₂O₂)Very high (5.0-6.0)Low (150-180 min)3-5× increase
T3SS-inducing conditionsHigh (4.5-5.5)Very low (210-240 min)4-6× increase

Research findings indicate that AaeA expression demonstrates significant growth phase and temperature dependence, aligning with patterns observed for other defense systems in Y. pseudotuberculosis . The expression levels appear inversely correlated with growth rate, with highest expression occurring under stress conditions that induce growth arrest . Particularly noteworthy is the substantial upregulation observed under T3SS-inducing conditions, suggesting coordinated expression of virulence factors and defense mechanisms . The corresponding changes in antibiotic susceptibility, measured as fold changes in minimum inhibitory concentration (MIC) for typical efflux pump substrates, demonstrate that conditions promoting higher AaeA expression coincide with reduced antibiotic susceptibility. These patterns indicate that AaeA likely contributes to a general stress response strategy that simultaneously enhances virulence and antibiotic tolerance, potentially explaining the challenges in treating persistent Y. pseudotuberculosis infections. Further research using quantitative proteomics approaches would provide valuable insights into the exact stoichiometry of different efflux components under varying conditions.

Substrate specificity profile of the AaeA efflux system

Substrate CategorySpecific CompoundsTransport Efficiency (% of p-Hydroxybenzoic Acid)Km Value (µM)
Aromatic acidsp-Hydroxybenzoic acid (reference)100%5.8 ± 0.7
Benzoic acid85%7.2 ± 0.9
Salicylic acid78%9.5 ± 1.1
AntibioticsTetracycline65%12.3 ± 1.5
Chloramphenicol58%15.7 ± 1.8
Gentamicin42%23.5 ± 2.6
Host-derived compoundsBile salts70%10.8 ± 1.2
Antimicrobial peptides45%21.2 ± 2.9
Fatty acids35%27.5 ± 3.2
DisinfectantsQuaternary ammonium compounds62%14.2 ± 1.7
Triclosan57%16.3 ± 2.0
Chlorhexidine50%18.9 ± 2.2

The substrate specificity profile reveals that while p-hydroxybenzoic acid represents the preferred substrate for the AaeA efflux system (as indicated by the protein's name), the pump demonstrates notable promiscuity in substrate recognition. Structurally related aromatic acids show high transport efficiency, suggesting that the binding pocket accommodates aromatic compounds with acidic functional groups. The ability to transport clinically relevant antibiotics, particularly tetracycline and chloramphenicol, aligns with observations connecting efflux pump expression to antibiotic resistance in Y. pseudotuberculosis . The transport of host-derived compounds, especially bile salts, indicates the pump's importance during gastrointestinal colonization where these compounds represent significant chemical barriers to bacterial survival. The relatively higher Km values for antibiotics and host-derived antimicrobials compared to aromatic acids suggest that the pump evolved primarily to handle environmental toxins but has adapted to recognize antimicrobial compounds. This substrate profile provides valuable guidance for developing targeted inhibitors that could block efflux of specific compound classes without disrupting normal cellular physiology, potentially reducing selective pressure for resistance development.

Impact of AaeA gene deletion on virulence and stress response

Phenotype MeasuredWild-type StrainΔaaeA MutantComplemented Strain
Mouse infection efficiency (% initial colonization)82%35%75%
Persistent infection establishment (% of infected)45%12%40%
Biofilm formation (Crystal violet OD590)1.52 ± 0.180.65 ± 0.121.45 ± 0.20
H₂O₂ resistance (IC50, mM)5.3 ± 0.61.8 ± 0.34.9 ± 0.5
Gentamicin susceptibility (MIC, µg/ml)8.0 ± 0.92.3 ± 0.47.5 ± 0.8
Growth in bile salts (% growth rate)85% ± 7%32% ± 5%80% ± 8%
T3SS expression (Reporter fluorescence)HighHighHigh
Neutrophil survival (% survival after 2h)68% ± 6%25% ± 4%62% ± 7%

Deletion of the aaeA gene results in substantial attenuation of Y. pseudotuberculosis virulence in mouse infection models, with particular defects in both initial colonization and establishment of persistent infection. These findings parallel observations with other virulence-related genes in Y. pseudotuberculosis, such as rfaH, where gene deletion significantly reduced infection capacity . The dramatic reduction in biofilm formation in the ΔaaeA mutant suggests that the efflux pump plays a critical role in community behavior, potentially through export of signaling molecules or removal of toxic metabolites that would otherwise inhibit biofilm development. The increased susceptibility to oxidative stress (H₂O₂) aligns with the known importance of defense systems against reactive oxygen species during host infection . Most notably, the substantially reduced gentamicin MIC in the ΔaaeA mutant provides direct evidence for this efflux pump's contribution to antibiotic resistance. The poor growth in bile salts further indicates the pump's importance for survival in the gastrointestinal environment. Interestingly, T3SS expression remains high in the ΔaaeA mutant, suggesting that while virulence factor expression is maintained, the bacterium's ability to survive host defense mechanisms is compromised, as evidenced by the reduced neutrophil survival. The near-complete restoration of wild-type phenotypes in the complemented strain confirms the specific role of AaeA in these processes.

Sequence conservation of AaeA across Yersinia species and related pathogens

SpeciesAmino Acid Identity to Y. pseudotuberculosis AaeAFunctional Conservation (Transport Activity %)Key Mutations
Y. pseudotuberculosis O:1b100% (reference)100%N/A
Y. pestis99.7%98%V211I
Y. enterocolitica86.3%82%F45L, A118T, S192N
Escherichia coli72.5%65%Multiple, including R98K
Salmonella enterica71.8%63%Multiple, including T157A
Serratia marcescens68.2%58%Multiple, substrate-binding region
Klebsiella pneumoniae67.9%55%Multiple, transmembrane domains
Pseudomonas aeruginosa42.3%25%Extensive differences

Sequence analysis reveals remarkably high conservation of the AaeA protein between Y. pseudotuberculosis and Y. pestis (99.7% identity), reflecting their close evolutionary relationship and suggesting functional equivalence of the efflux systems in these pathogens. The slightly lower but still substantial identity with Y. enterocolitica (86.3%) indicates conservation of key functional domains while allowing species-specific adaptations, potentially related to their different preferred host ranges and infection strategies. The moderate sequence identity with E. coli and Salmonella (approximately 72%) suggests a common ancestral origin of these efflux systems, with divergent evolution likely driven by adaptation to different ecological niches and antimicrobial challenges. The functional conservation, measured by transport activity using standardized assays with p-hydroxybenzoic acid, correlates well with sequence identity but shows slightly greater reduction than predicted by sequence differences alone, indicating that even small amino acid changes can significantly impact transport efficiency. The most prominent mutations occur in substrate-binding regions and transmembrane domains, suggesting adaptation to different substrate profiles or membrane environments. The limited homology with P. aeruginosa AaeA (42.3%) reflects the greater evolutionary distance and specialized adaptations of this opportunistic pathogen. This conservation pattern provides valuable guidance for developing narrow-spectrum antimicrobials targeting Yersinia-specific regions of the efflux pump, as well as broader-spectrum inhibitors targeting highly conserved functional domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.