Recombinant Yersinia pseudotuberculosis serotype O:1b Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Yersinia pseudotuberculosis serotype O:1b ArnE is a genetically engineered protein involved in the lipopolysaccharide (LPS) modification pathway of the Gram-negative bacterium Yersinia pseudotuberculosis. This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose (L-Ara4N)-phosphoundecaprenol, a lipid-linked sugar intermediate, from the cytoplasmic to the periplasmic leaflet of the inner membrane . This modification enhances bacterial resistance to cationic antimicrobial peptides (CAMPs), a critical survival mechanism during host infection .

Protein Architecture

  • Gene Cluster: ArnE is encoded within the arn operon, which includes genes responsible for L-Ara4N biosynthesis and incorporation into lipid A .

  • Domains:

    • Contains an EamA-like transporter domain, typical of membrane-bound flippases involved in lipid transport .

    • Predicted transmembrane helices for embedding in the inner membrane .

Mechanistic Role

ArnE functions as a flippase, catalyzing the ATP-independent translocation of L-Ara4N-phosphoundecaprenol across the inner membrane. This step is essential for the subsequent transfer of L-Ara4N to lipid A, reducing its net negative charge and evading host immune defenses .

Role in Virulence

  • Lipid A Modification: ArnE-mediated L-Ara4N incorporation into LPS is critical for evading CAMPs in host environments, such as intestinal mucosa .

  • Serotype-Specific Adaptation: The O:1b serotype’s arn operon shares hybrid features with O:5a and O:15 serotypes, suggesting evolutionary recombination events to optimize LPS structure for host adaptation .

Antimicrobial Resistance Studies

  • Target for Inhibitors: ArnE’s role in CAMP resistance makes it a potential target for novel antibiotics .

  • Structural Biology: Recombinant ArnE is used in X-ray crystallography and cryo-EM to map flippase mechanisms .

Comparative Pathogenesis

  • Studies compare ArnE across Yersinia serotypes to elucidate host-pathogen coevolution .

Gene Cluster Comparison of Y. pseudotuberculosis Serotypes

SerotypeBackbone StructureBranching SugarGene Cluster Origin
O:1b→2)-α-D-Manp-(1→4)-α-D-Manp-(1→...)β-D-Paratofuranose (Parf)Hybrid of O:1b and O:5a
O:5a→3)-α-D-GalpNAc-(1→4)-α-L-Fucp-(1→...NoneUnique to O:5a

Recombinant ArnE Suppliers

SupplierCatalog NumberPurityApplication
Creative BioMartRFL24082SF>95%Structural studies, assays
CUSABIO TECHNOLOGY LLCCB915633407>90%Enzyme activity assays

Future Directions

  • Mechanistic Studies: Elucidate the conformational changes during L-Ara4N-phosphoundecaprenol flipping .

  • Therapeutic Development: Screen small-molecule inhibitors targeting ArnE’s EamA domain .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; YpsIP31758_1730; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
arnE
Target Protein Sequence
MNSYLLLLMVSLLTCIGQLCQKQAAQCWEQPQARRLNLTLRWLAIAVVSLGLGMLLWLRL LQQLPLSVAYPMLSFNFVLVTLAAQLFYGEKATLRHWLGVAAIIFGILLMSWHL
Uniprot No.

Target Background

Function
Facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of arnE relate to its flippase functionality?

ArnE belongs to a class of membrane proteins that facilitate the "flipping" of lipid molecules from one leaflet of the membrane to another. Although the precise structure of Y. pseudotuberculosis arnE has not been fully characterized, insights can be drawn from research on related flippase structures. P4-ATPase lipid flippases, which share functional similarities with bacterial flippases, work through conformational changes that create pathways for lipid movement across membrane leaflets . The structure typically includes multiple transmembrane domains that form a passage for lipid head groups while allowing the hydrophobic tails to remain within the membrane environment. Research on similar bacterial flippases suggests that conserved arginine residues may play critical roles in substrate recognition and orientation, as observed with Arg151 in related systems which helps guide lipid binding at proposed entry sites .

What genomic features characterize the arnE gene in pathogenic Yersinia strains?

The arnE gene in Yersinia species is typically located within genomic regions associated with membrane modification and antimicrobial resistance. Whole-genome sequencing studies of Yersinia have revealed that arnE is conserved across pathogenic strains, suggesting evolutionary pressure to maintain this function . Comparative genomic analyses between Y. pseudotuberculosis and Y. pestis show high sequence conservation in membrane modification genes, with arnE exhibiting key features that distinguish pathogenic from non-pathogenic strains . The genomic context of arnE often includes other genes involved in lipopolysaccharide modification pathways, forming functionally related gene clusters. Multi-locus sequence typing and virulence gene profiling using whole-genome sequencing data have proven valuable for characterizing these genomic features in clinical isolates .

What are the optimal expression systems for recombinant Y. pseudotuberculosis arnE?

For recombinant expression of Y. pseudotuberculosis arnE, several expression systems can be employed with specific considerations for this membrane protein. E. coli-based expression systems using vectors with tunable promoters (such as pET series with T7 promoter) are commonly used for initial expression trials. For membrane proteins like arnE, using E. coli strains designed for membrane protein expression (C41, C43) can significantly improve yields. Expression conditions require careful optimization: lower temperatures (16-20°C), reduced inducer concentrations, and longer induction times often improve proper folding. For higher yields or when E. coli expression is problematic, eukaryotic systems such as Pichia pastoris or insect cells may be considered, though with potential glycosylation differences. Fusion tags can aid in expression and purification, with His6 tags being common for metal affinity purification, though their placement (N- or C-terminal) should be tested empirically to determine which better preserves protein functionality .

How can whole-genome sequencing approaches be utilized to study arnE variants across Yersinia strains?

Whole-genome sequencing (WGS) provides comprehensive insights into arnE variants across Yersinia strains with several methodological advantages over traditional approaches. When implementing WGS for arnE analysis, researchers should consider: (1) Sequencing depth of at least 30-50x coverage to ensure accurate variant calling; (2) Use of both short-read (Illumina) and long-read (PacBio, Oxford Nanopore) technologies for complete genome assembly; (3) Application of kmer-based identification approaches, which have shown 100% accuracy in identifying Yersinia species . Comparative genomic analysis should include identification of single nucleotide polymorphisms, insertions/deletions, and structural variations that may affect protein function. Traditional biochemical identification methods identified only 82/158 Y. enterocolitica isolates compared to 118/158 identified by genome-derived methods, demonstrating the superior resolution of WGS approaches . Data interpretation should include evolutionary analyses to understand selection pressures on arnE and correlation of variants with antimicrobial resistance profiles.

What techniques are most effective for studying protein-protein interactions involving arnE?

Several complementary techniques can be employed to study protein-protein interactions involving the membrane protein arnE, each with specific advantages for different research questions. Co-immunoprecipitation (Co-IP) using antibodies against arnE or its potential interacting partners can identify native complexes from Yersinia cell lysates. For in vitro studies, pull-down assays using recombinant tagged arnE can verify direct interactions. Crosslinking coupled with mass spectrometry (XL-MS) is particularly valuable for identifying transient interactions and mapping interaction interfaces at amino acid resolution. Bacterial two-hybrid systems and split-GFP approaches can verify interactions in a cellular context. Studying interactions in membrane environments is critical for arnE, requiring techniques like biolayer interferometry or surface plasmon resonance using membrane mimetics (nanodiscs or liposomes). Researchers should note that tight complexes between membrane proteins can form on both cytosolic and lumenal sides with extensive interactions, as observed with the Drs2p-Cdc50p flippase complex, where interactions occur on multiple surfaces and within the membrane .

How does arnE contribute to antimicrobial resistance mechanisms in Y. pseudotuberculosis?

The arnE protein plays a crucial role in antimicrobial resistance through its function in LPS modification pathways. As a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, arnE mediates the translocation of aminoarabinose precursors across the inner membrane, which are subsequently incorporated into lipid A. This modification reduces the negative charge of the bacterial outer membrane, decreasing the electrostatic affinity for cationic antimicrobial peptides (CAMPs) and polymyxins. Experimental approaches to study this mechanism include: (1) Generation of arnE deletion mutants followed by minimum inhibitory concentration (MIC) testing against various antimicrobials; (2) Mass spectrometry analysis of lipid A structures to confirm changes in LPS modification patterns; (3) Membrane permeability assays using fluorescent probes to assess changes in membrane integrity. Studies of similar modification systems show that loss of proper membrane modification can render bacteria up to 1000-fold more susceptible to certain antimicrobials . Additionally, the flippase function of arnE represents a potential drug target, as inhibition of this protein could potentially re-sensitize resistant bacteria to existing antibiotics.

What is the relationship between arnE function and Y. pseudotuberculosis type III secretion system (T3SS) efficiency?

The relationship between arnE function and T3SS efficiency involves complex membrane dynamics that affect virulence protein expression and secretion. T3SS is a sophisticated needle-like apparatus that injects effector proteins into host cells, and its assembly and function are highly dependent on membrane properties that arnE helps maintain . Research approaches to investigate this relationship should include: (1) Comparative proteomics analysis of wild-type and arnE mutant secretomes to quantify differences in T3SS effector secretion; (2) Real-time RT-PCR to assess transcriptional changes in T3SS genes when arnE is altered; (3) Fluorescence microscopy of T3SS components to evaluate assembly efficiency in different genetic backgrounds. Studies on related systems have shown that mutations affecting translational control systems can cause severe deficiencies in expression and secretion of virulence effector proteins at the transcriptional level . The SmpB-SsrA system in Y. pseudotuberculosis demonstrates how disruption of translational quality control renders bacteria avirulent and unable to cause mortality in mice, with specific defects in T3SS-mediated host cell cytotoxicity . When designing experiments, researchers should account for potential polar effects of arnE mutations on adjacent genes and consider the use of complementation studies to confirm phenotypes.

How does environmental iron availability affect arnE expression and function?

Iron availability significantly influences arnE expression and function through regulatory networks that coordinate membrane modification with iron acquisition systems. Under iron-limited conditions, Yersinia species upregulate various iron acquisition mechanisms, including the yersiniabactin siderophore system encoded by the high-pathogenicity island (HPI) . Researchers investigating this relationship should employ: (1) Quantitative transcriptomics comparing arnE expression under iron-replete versus iron-depleted conditions; (2) Chromatin immunoprecipitation sequencing (ChIP-seq) to identify potential transcription factors binding to the arnE promoter region under different iron conditions; (3) Reporter gene assays using the arnE promoter fused to luciferase or GFP to monitor real-time expression changes. The relationship between iron acquisition systems and membrane modification genes like arnE may involve coordinated regulation to optimize bacterial survival during infection. Studies on the Y. pseudotuberculosis HPI have shown that iron-acquisition systems can form mobile genetic elements capable of excision and integration , suggesting potential co-regulation with membrane modification genes during horizontal gene transfer events. When designing experiments to study iron-dependent regulation, researchers should consider the use of iron chelators (e.g., 2,2'-bipyridyl), iron-supplemented media, and mutants in iron regulatory genes.

What are the key considerations when designing knockout studies for arnE in Y. pseudotuberculosis?

When designing knockout studies for arnE in Y. pseudotuberculosis, researchers should carefully consider multiple technical aspects to ensure valid and interpretable results. Gene deletion strategies should prioritize non-polar mutations that don't affect downstream genes, using techniques like lambda Red recombineering with FLP-mediated removal of antibiotic markers. Researchers must verify knockouts through both PCR verification and whole-genome sequencing to confirm the absence of compensatory mutations. Complementation studies are essential, preferably using native promoters and single-copy integration to avoid overexpression artifacts. Phenotypic characterization should be comprehensive, including growth curves under various conditions (temperature, pH, osmolarity), antimicrobial susceptibility testing, membrane integrity assays, and in vitro and in vivo virulence assays. Control strains should include both wildtype and strains with mutations in related but functionally distinct genes. Particular attention should be paid to potential membrane perturbations from deletion of a membrane protein, which may cause indirect effects beyond the specific role of arnE. Studies of the SmpB-SsrA system have demonstrated that comprehensive phenotypic testing (including growth in hostile environments, macrophage proliferation assays, and in vivo virulence models) is necessary to fully characterize the impact of mutations affecting bacterial stress responses .

What analytical techniques are optimal for characterizing the flippase activity of recombinant arnE?

Characterizing the flippase activity of recombinant arnE requires specialized techniques that can detect the translocation of lipid substrates across membranes. Researchers should consider implementing: (1) Reconstitution of purified arnE into proteoliposomes with fluorescently labeled lipid analogs to directly monitor transbilayer movement; (2) Use of dithionite quenching assays, where the reducing agent dithionite quenches NBD-labeled lipids on the outer leaflet, allowing quantification of protected inner leaflet lipids; (3) Implementation of stopped-flow spectrofluorimetry to capture rapid kinetics of flipping events. For more detailed mechanistic studies, researchers can employ: (4) Site-directed mutagenesis of conserved residues followed by activity assays to identify catalytic and regulatory domains; (5) Accessibility mapping using substituted cysteine accessibility method (SCAM) to determine transmembrane topology and substrate translocation pathway. Analysis of P4-ATPase flippases has revealed important architectural features that may apply to bacterial flippases, including the existence of specific cytosolic and membrane interactions that are essential for function . When designing activity assays, it's critical to control for non-specific leakage and to verify that observed activity is ATP-dependent if arnE functions as part of an active transport complex.

What are the optimal conditions for structural studies of arnE using cryo-electron microscopy?

For successful structural characterization of arnE using cryo-electron microscopy (cryo-EM), researchers should optimize multiple parameters throughout the experimental pipeline. Protein preparation requires careful attention to: (1) Expression optimization in systems that provide sufficient yields while maintaining native folding; (2) Detergent selection, trying multiple options such as DDM, LMNG, or GDN for extraction with subsequent validation of protein activity; (3) Protein purification to >95% homogeneity with size-exclusion chromatography as a final step. For cryo-EM specific considerations: (1) Evaluate protein stability in various buffer conditions using thermal shift assays to identify formulations that maximize particle uniformity; (2) Test reconstitution into nanodiscs or amphipols as alternatives to detergent micelles for better mimicking of the native membrane environment; (3) Optimize grid preparation parameters including protein concentration (typically 0.5-5 mg/mL), blotting time, and ice thickness. Data collection strategies should include: (1) Collection of pilot datasets to assess sample quality before extensive data acquisition; (2) Implementation of beam-induced motion correction; (3) Collection of tilt-series data if preferred orientations are observed. Recent advances in cryo-EM have enabled determination of membrane protein structures at near-atomic resolution, as demonstrated with P4-ATPase lipid flippases , making this a promising approach for arnE structural studies.

How can contradictory results in arnE functional studies be reconciled and interpreted?

When faced with contradictory results in arnE functional studies, researchers should implement a systematic approach to reconciliation that addresses both technical and biological factors. First, evaluate experimental differences between studies, including strain backgrounds, growth conditions, and methodological variations in assays. Genetic context is particularly important, as the function of arnE may depend on the presence of partner proteins or regulatory elements that vary between laboratory strains. Second, consider environmental influences that might affect arnE function, such as temperature, pH, and ion concentrations, which can significantly impact membrane protein behavior. Third, examine post-translational modifications or conformational states that might not be captured in all experimental systems. When analyzing contradictory findings, researchers should implement: (1) Side-by-side comparisons using standardized protocols; (2) Multiple complementary techniques to confirm key findings; (3) Genetic complementation to verify phenotype specificity. The complex interactions between bacterial membrane proteins and their environments can lead to context-dependent functions, as seen with the integrase (Int) protein in Y. pseudotuberculosis, which requires an additional factor (Hef) for efficient recombination between attachment sites .

What is the significance of arnE in developing novel antimicrobial strategies against Yersinia infections?

The arnE protein represents a promising target for novel antimicrobial strategies due to its essential role in membrane modification pathways that contribute to bacterial survival and virulence. As a component of the LPS modification system, arnE contributes to resistance against host immune defenses and conventional antibiotics, making it an attractive candidate for therapeutic intervention. Researchers developing arnE-targeted antimicrobials should consider several approaches: (1) High-throughput screening of small molecule libraries to identify specific inhibitors of flippase activity; (2) Structure-based drug design once structural data becomes available; (3) Combination therapy approaches where arnE inhibitors could sensitize bacteria to existing antibiotics. The potential impact of such strategies is significant, as disruption of membrane modification systems can render pathogenic bacteria avirulent and highly susceptible to host immune clearance . When developing screening assays, researchers should include counter-screens against mammalian flippases to ensure selectivity. Preliminary data generation should include evaluation of resistance development frequency and assessment of efficacy in various infection models. The detailed characterization of microbial membrane modification systems through whole-genome sequencing and functional studies provides crucial information for these antimicrobial development efforts .

How can research on Y. pseudotuberculosis arnE inform understanding of similar systems in related pathogenic bacteria?

Research on Y. pseudotuberculosis arnE has broad implications for understanding similar membrane modification systems across numerous bacterial pathogens. Comparative genomics and functional studies of arnE can inform research on related pathogens through several approaches: (1) Identification of conserved structural and functional motifs that can be targeted for broad-spectrum interventions; (2) Elucidation of species-specific adaptations that contribute to niche specialization; (3) Understanding of horizontal gene transfer events that disseminate antimicrobial resistance mechanisms. Researchers conducting comparative studies should implement: (1) Phylogenetic analyses to map the evolutionary relationships between arnE homologs; (2) Complementation studies where arnE genes from different species are expressed in Y. pseudotuberculosis mutants to assess functional conservation; (3) Structural comparisons to identify conserved binding sites or catalytic domains. The high-pathogenicity island (HPI) of Y. pseudotuberculosis provides a model for how gene clusters involved in virulence can excise, circularize, and reintegrate into genomes , suggesting similar mechanisms might facilitate transfer of membrane modification genes between species. The fact that pathogenicity islands carry machinery highly similar to bacteriophage integration/excision systems argues for phage-mediated acquisition and transfer of these elements , providing insight into the evolutionary history of these critical virulence determinants.

What are common challenges in purifying recombinant arnE protein and how can they be addressed?

Purification of recombinant arnE protein presents several challenges typical of integral membrane proteins, requiring specific strategies for successful isolation. Common challenges include low expression levels, protein aggregation, loss of structural integrity during extraction, and co-purification of contaminants. To address these issues, researchers should implement: (1) Optimization of expression systems, testing multiple host strains and expression conditions with small-scale trials before scaling up; (2) Careful selection of detergents, starting with mild non-ionic detergents (DDM, LMNG) and screening alternatives if initial results are unsatisfactory; (3) Implementation of efficient solubilization protocols with optimized detergent:protein ratios and incubation times. For affinity purification, researchers should consider: (1) Testing both N- and C-terminal tags to identify positions that don't interfere with folding; (2) Including adequate washing steps with detergent-containing buffers to remove lipids and contaminants; (3) Using size exclusion chromatography as a final purification step to separate properly folded protein from aggregates. Protein stability can be enhanced by: (1) Addition of specific lipids that stabilize the native conformation; (2) Maintaining glycerol (10-15%) in all buffers; (3) Including protease inhibitors throughout the purification process. Successful purification should be verified by multiple methods including SDS-PAGE, Western blotting, and where possible, functional activity assays.

How can researchers verify the proper folding and functionality of purified arnE protein?

Verifying proper folding and functionality of purified arnE protein requires multiple complementary approaches that assess both structural integrity and biological activity. For structural assessment, researchers should implement: (1) Circular dichroism (CD) spectroscopy to evaluate secondary structure content and compare with theoretical predictions; (2) Thermal shift assays to assess protein stability under various buffer conditions; (3) Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity and appropriate oligomeric state. Functional verification requires development of specific activity assays such as: (1) Reconstitution into proteoliposomes followed by flippase activity measurements using fluorescent lipid analogs; (2) ATPase activity assays if arnE functions as part of an ATP-dependent complex; (3) Lipid binding assays using approaches such as microscale thermophoresis or isothermal titration calorimetry. Additionally, researchers can implement: (1) Limited proteolysis to verify compact folding with defined domains; (2) Tryptophan fluorescence spectroscopy to assess tertiary structure integrity; (3) Negative stain electron microscopy to visualize protein particles and assess homogeneity. Similar approaches have been successful in characterizing other membrane proteins including P4-ATPase lipid flippases, where functional reconstitution and activity measurements were essential for correlating structure with function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.