Recombinant Yersinia pseudotuberculosis serotype O:1b Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
arnF; YpsIP31758_1731; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
arnF
Target Protein Sequence
MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYFVQLASVMCGLMGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATLLKTLGAGFILLGIWLI NIKPIKAS
Uniprot No.

Target Background

Function

This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.

Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ArnF in Yersinia pseudotuberculosis?

ArnF functions as a critical subunit of the flippase that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane in Yersinia pseudotuberculosis . This translocation process represents an essential step in bacterial outer membrane biogenesis, particularly within lipopolysaccharide (LPS) biosynthesis pathways . The protein operates as part of a heterodimeric complex, partnering with ArnE to facilitate this membrane transport function .

The biological significance of this process extends beyond basic bacterial physiology, as modifications to lipopolysaccharide structure through the addition of 4-amino-4-deoxy-L-arabinose can significantly alter bacterial surface properties, potentially affecting virulence and antibiotic resistance profiles. The protein contains a distinctive EamA domain characteristic of the ArnF family of membrane transporters, which provides its specific substrate recognition capabilities .

What is the evolutionary relationship between Yersinia pseudotuberculosis serotype O:1b and Yersinia pestis regarding the arnF gene?

Yersinia pestis, the causative agent of bubonic plague, evolved directly from Yersinia pseudotuberculosis serotype O:1b, with genetic analysis revealing remarkably high homology between these organisms . Comparative genomic studies of their O-antigen gene clusters demonstrate 98.9% identity at the nucleotide level across approximately 20.5 kb regions . Despite this close evolutionary relationship, Y. pestis exhibits a cryptic (non-functional) O-antigen gene cluster, whereas Y. pseudotuberculosis maintains a fully functional biosynthetic pathway .

The O-antigen cluster of Y. pseudotuberculosis serotype O:1b contains 17 identifiable biosynthetic genes, five of which became inactivated during the evolution of Y. pestis . These genetic modifications occurred through small-scale mutations: four genes were disrupted by insertions or deletions of single nucleotides, while another was rendered non-functional by a 62-nucleotide deletion . This evolutionary divergence in the O-antigen locus, including potential changes to arnF functionality, likely contributed to the dramatic differences in virulence mechanisms and host tropism between these closely related pathogens.

What is the structural organization of the ArnF protein?

The ArnF protein is classified as a multi-pass membrane protein located in the bacterial inner membrane . Structurally, it contains one EamA domain, which is characteristic of the ArnF protein family . This domain is typically associated with metabolite transport functions across membranes. The protein functions as part of a heterodimeric complex with ArnE, creating a functional flippase unit that facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the membrane barrier .

The transmembrane topology of ArnF positions it to interact with both the cytoplasmic and periplasmic environments, enabling it to accept the substrate from cytoplasmic biosynthetic enzymes and release it to periplasmic processing machinery. This structural arrangement is integral to its function in lipopolysaccharide modification pathways. The protein likely contains multiple transmembrane helices that create a substrate channel or pore through which the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol molecule passes during the flipping process.

What techniques are optimal for expressing and purifying recombinant ArnF for structural studies?

Recombinant expression and purification of integral membrane proteins like ArnF present significant technical challenges that require specialized approaches. For optimal expression, a dual-vector system employing both the arnE and arnF genes is recommended to maintain the natural heterodimeric complex structure. Expression systems using E. coli strains C41(DE3) or C43(DE3), specifically designed for membrane protein production, generally yield better results than standard BL21(DE3) strains.

For expression construct design, incorporating a C-terminal histidine tag on ArnF allows for purification while minimizing interference with membrane insertion. The addition of fusion partners such as maltose-binding protein (MBP) or green fluorescent protein (GFP) can enhance protein solubility and provide convenient methods for monitoring expression levels. Expression should be conducted at lower temperatures (16-20°C) following induction with reduced IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation.

Membrane extraction requires careful optimization, with a two-step solubilization process often proving most effective: initial membrane isolation through ultracentrifugation followed by selective solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). Purification typically employs immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to isolate the intact ArnE-ArnF complex. Throughout purification, maintaining the critical micelle concentration (CMC) of the selected detergent is essential for protein stability and activity.

How can researchers assess the flippase activity of ArnF in vitro?

Evaluating the flippase activity of ArnF requires specialized assays that can monitor the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across membrane barriers. A comprehensive methodological approach includes:

  • Reconstitution System: Purified ArnE-ArnF complexes should be reconstituted into proteoliposomes using lipid compositions that mimic the native bacterial inner membrane. Typically, a mixture of E. coli polar lipids and phosphatidylglycerol at a 7:3 ratio provides an appropriate environment.

  • Substrate Preparation: Radiolabeled or fluorescently tagged 4-amino-4-deoxy-L-arabinose precursors can be enzymatically converted to the phosphoundecaprenol form using purified upstream pathway enzymes. Alternatively, synthetic substrate analogs with spectroscopic properties can be employed.

  • Translocation Assays: Several complementary approaches can assess flippase activity:

    • Back-extraction assay: Measures the protection of labeled substrate from membrane-impermeable extracting agents

    • Fluorescence quenching: Uses fluorescence resonance energy transfer (FRET) to detect substrate movement between membrane leaflets

    • Mass spectrometry: Quantifies substrate appearance in the outer leaflet after proteolytic digestion of accessible protein portions

  • Kinetic Analysis: Time-course experiments measuring initial rates at varying substrate concentrations can determine kinetic parameters (Km, Vmax) of the transport process, ideally comparing wild-type ArnF to site-directed mutants affecting key functional residues.

  • Inhibition Studies: Competitive inhibitors, ATP depletion, or proton gradient disruptors can help elucidate the energy requirements and mechanism of substrate translocation.

These methodologies collectively provide a robust framework for characterizing the fundamental biochemical properties of ArnF-mediated flippase activity.

What are the current approaches for investigating ArnF-mediated lipopolysaccharide modifications in pathogenesis?

Investigating the role of ArnF in pathogenesis through lipopolysaccharide modifications requires multidisciplinary approaches spanning genetic, biochemical, and infection model techniques:

  • Genetic Manipulation Strategies:

    • Clean deletion mutants of arnF can be generated using homologous recombination or CRISPR-Cas9 systems optimized for Y. pseudotuberculosis

    • Complementation studies with both wild-type and point-mutated arnF variants can verify phenotypes and identify critical functional residues

    • Conditional expression systems using inducible promoters enable temporal control of arnF expression during different infection stages

  • Lipopolysaccharide Analysis Methods:

    • Mass spectrometry characterization using MALDI-TOF and tandem MS/MS to identify specific 4-amino-4-deoxy-L-arabinose modifications

    • Silver staining and Western blotting of LPS preparations to detect migration pattern changes reflecting altered O-antigen structure

    • NMR spectroscopy of purified LPS to determine precise structural modifications

  • Virulence Assessment in Animal Models:

    • Mouse models of yersiniosis using oral infection routes can assess colonization, dissemination, and mortality rates between wild-type and arnF mutants

    • Competitive infection assays where wild-type and mutant strains are co-administered can provide sensitive measurements of fitness differences in vivo

    • Tissue-specific bacterial burden quantification enables tracking of infection progression through different anatomical sites

  • Host Response Characterization:

    • Cytokine profiling from infected tissues can detect differences in inflammatory responses triggered by modified LPS structures

    • Phagocytosis assays using macrophages or neutrophils measure the impact of ArnF-dependent modifications on bacterial clearance

    • Antimicrobial peptide sensitivity testing evaluates how LPS modifications affect resistance to host defense molecules

These integrative approaches can establish causal relationships between ArnF activity, specific lipopolysaccharide modifications, and virulence phenotypes in Y. pseudotuberculosis serotype O:1b.

How does ArnF expression interface with small RNA regulatory networks in Yersinia pseudotuberculosis?

The expression and function of ArnF in Y. pseudotuberculosis likely intersects with the complex small RNA (sRNA) regulatory networks that have been shown to play crucial roles in virulence regulation. Research has demonstrated that Hfq, an RNA chaperone that mediates the interaction of many sRNAs with their targets, is required for full virulence of Y. pseudotuberculosis, with hfq deletion resulting in a dramatic 10,000-fold attenuation in mouse models of yersiniosis . This indicates that post-transcriptional regulation by sRNAs significantly impacts virulence factor expression.

Deep sequencing approaches have identified 150 unannotated sRNAs in Y. pseudotuberculosis, with most being Yersinia-specific and lacking orthologs in related enteric bacteria like Escherichia coli or Salmonella typhimurium . The expression patterns of these sRNAs vary significantly between growth at 26°C (environmental temperature) and 37°C (host temperature), suggesting temperature-dependent regulation relevant to the transition between environmental persistence and mammalian infection .

While direct regulation of arnF by specific sRNAs has not been explicitly documented in the provided research data, the outer membrane modification pathways in which ArnF participates are typically subject to complex regulation, including post-transcriptional control. Researchers investigating this relationship should consider:

  • Comparative transcriptomics between wild-type and hfq mutant strains to identify changes in arnF mRNA levels

  • RNA immunoprecipitation with Hfq followed by sequencing to detect potential binding of Hfq to arnF transcripts

  • Bioinformatic prediction of sRNA binding sites in the arnF mRNA sequence, focusing on the translation initiation region

  • Construction of reporter fusions to monitor arnF expression in strains with deletions of candidate regulatory sRNAs

The deletion of multiple sRNAs in Y. pseudotuberculosis has been shown to attenuate virulence in mouse models, reinforcing the importance of this regulatory layer in pathogenesis .

What is the relationship between ArnF function and antimicrobial resistance in Yersinia pseudotuberculosis?

The functional relationship between ArnF and antimicrobial resistance stems from its fundamental role in lipopolysaccharide modification. As a subunit of the flippase that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic to the periplasmic side of the bacterial inner membrane , ArnF directly contributes to the addition of 4-amino-4-deoxy-L-arabinose to lipid A in the bacterial outer membrane. This modification is a well-documented mechanism for resistance against cationic antimicrobial peptides and certain antibiotics, particularly polymyxins.

The addition of positively charged 4-amino-4-deoxy-L-arabinose groups to lipid A reduces the negative charge of the bacterial surface, thereby decreasing the electrostatic attraction between the membrane and cationic antimicrobials. Without functional ArnF, this modification process would be disrupted, potentially increasing bacterial susceptibility to host defense peptides during infection and to certain clinical antibiotics.

Research approaches to investigate this relationship should include:

  • Minimum inhibitory concentration (MIC) determination comparing wild-type and arnF mutant strains against a panel of antimicrobial compounds, with particular attention to:

    • Polymyxin B and colistin (polymyxin E)

    • Human β-defensins and cathelicidins

    • Other cationic antimicrobial agents

  • Membrane permeability assays using fluorescent dyes (propidium iodide, SYTOX Green) to quantify the impact of ArnF deletion on membrane integrity following antimicrobial exposure

  • Time-kill kinetics to characterize the dynamics of bacterial killing in arnF mutants compared to wild-type strains

  • Selection experiments under antimicrobial pressure to identify compensatory mutations in arnF mutant backgrounds that restore resistance

  • Comparative analysis of lipid A modifications using mass spectrometry to directly correlate changes in 4-amino-4-deoxy-L-arabinose incorporation with antimicrobial susceptibility profiles

This relationship between ArnF function and antimicrobial resistance has significant implications for both the basic understanding of Y. pseudotuberculosis pathogenesis and potential therapeutic approaches targeting this pathway.

How does ArnF from Yersinia pseudotuberculosis serotype O:1b compare with homologs in other bacterial pathogens?

The ArnF protein from Y. pseudotuberculosis serotype O:1b shares significant structural and functional similarities with homologs in other Gram-negative bacterial pathogens, while also possessing unique characteristics that may relate to Yersinia-specific aspects of pathogenesis. Comparative analysis reveals:

Bacterial SpeciesArnF Identity (%)Key Functional DifferencesLPS Modification Impact
Yersinia pestis>98%Cryptic in Y. pestis due to mutations in O-antigen clusterContributes to altered host range and virulence mechanism
Salmonella enterica~65-70%Different regulatory control; induced by PhoP/PhoQCritical for resistance to host antimicrobial peptides
Pseudomonas aeruginosa~55-60%Constitutively expressed in many clinical isolatesAssociated with chronic infection adaptation
Escherichia coli~60-65%Lower expression levels under standard conditionsImportant for environmental persistence
Burkholderia spp.~45-50%Part of expanded arnBCADTEF operonIntrinsic polymyxin resistance

The ArnF protein from Y. pseudotuberculosis contains the characteristic EamA domain found across this protein family , but sequence analysis suggests subtle differences in transmembrane helices arrangement compared to homologs from other species. These variations may influence substrate specificity or interaction with partner proteins.

Functionally, the Y. pseudotuberculosis ArnF works within a pathway that is structurally conserved across Gram-negative bacteria, but with species-specific regulatory networks. While most bacterial species regulate this pathway primarily through two-component systems responding to environmental signals like low magnesium or low pH, the regulatory inputs controlling arnF expression in Y. pseudotuberculosis may include unique factors related to its distinctive lifestyle as both an environmental organism and a pathogen capable of causing enteric disease.

The evolutionary pattern of ArnF conservation between Y. pseudotuberculosis and Y. pestis, despite the inactivation of several other genes in the O-antigen cluster , suggests selective pressure to maintain this function even during the evolutionary specialization of Y. pestis as a vector-borne pathogen.

What evolutionary insights can be gained from studying differences in ArnF between Yersinia pseudotuberculosis and Yersinia pestis?

The evolutionary relationship between Y. pseudotuberculosis and Y. pestis provides a remarkable natural experiment for understanding bacterial pathogen evolution, with ArnF serving as an informative molecular marker in this process. Genetic analysis has conclusively demonstrated that Y. pestis evolved from Y. pseudotuberculosis serotype O:1b relatively recently in evolutionary history . While the O-antigen gene clusters of these organisms show 98.9% nucleotide identity across their approximately 20.5 kb span, selective inactivation of specific genes has occurred during this evolutionary transition .

The fact that the O-antigen gene cluster became cryptic in Y. pestis through inactivation of five of the 17 biosynthetic genes identified in the Y. pseudotuberculosis O:1b cluster represents a classic example of reductive evolution during host adaptation. These inactivations occurred through small-scale mutations: four genes were disrupted by insertions or deletions of single nucleotides, while another was rendered non-functional by a 62-nucleotide deletion .

Several evolutionary insights emerge from comparing ArnF and associated pathways between these species:

  • Selective Gene Inactivation: The pattern of gene inactivation in the O-antigen cluster suggests specific selective pressures during the adaptation of Y. pestis to its new transmission cycle involving fleas and mammals.

  • Functional Conservation: If ArnF function remains intact in Y. pestis despite inactivation of other O-antigen genes, this suggests its role extends beyond O-antigen synthesis to other aspects of bacterial physiology such as antimicrobial resistance.

  • Regulatory Rewiring: The expression patterns of many sRNAs conserved between Y. pseudotuberculosis and Y. pestis differ in both timing and dependence on Hfq , suggesting evolutionary changes in posttranscriptional regulation between these species that may affect ArnF expression.

  • Host Adaptation Signatures: Differences in ArnF sequence or expression between these species may reflect adaptation to different host environments – enteric infection for Y. pseudotuberculosis versus systemic and vector-borne infection for Y. pestis.

These evolutionary insights from ArnF comparison contribute to our broader understanding of how bacterial pathogens adapt to new ecological niches and transmission cycles, with potential implications for predicting the emergence of new pathogens.

What is the clinical relevance of understanding ArnF function in Yersinia pseudotuberculosis infections?

Understanding ArnF function in Y. pseudotuberculosis has several important clinical implications, particularly regarding infection mechanisms, disease progression, and treatment approaches. Y. pseudotuberculosis is a soil- and water-borne enteropathogen that causes yersiniosis in humans, characterized by ileitis, mesenteric lymphadenitis, fever, and diarrhea . While typically self-limiting in immunocompetent individuals, severe complications can occur, especially in immunocompromised patients.

Cases of Y. pseudotuberculosis septicemia have been documented in HIV-positive patients with significant immunodeficiency . The study described two cases of community-acquired septicemia caused by serotype-O1 Y. pseudotuberculosis diagnosed in middle-aged, HIV-positive, immunodeficient patients during an 8-month period . This suggests that HIV-related immunosuppression represents a significant risk factor for invasive Y. pseudotuberculosis infections .

The clinical relevance of ArnF function manifests in several key areas:

  • Antimicrobial Treatment Efficacy: As ArnF contributes to lipopolysaccharide modifications that can reduce susceptibility to cationic antimicrobial peptides and certain antibiotics, understanding its function may explain treatment failures or guide antibiotic selection. Both case studies documented in the research responded to ceftriaxone therapy despite the typically difficult clinical management and high mortality rates (~75%) associated with Y. pseudotuberculosis septicemia .

  • Virulence Assessment: The contribution of ArnF to bacterial survival during infection may serve as a marker for strain virulence potential, helping clinicians assess infection severity risk.

  • Host-Pathogen Interactions: ArnF-mediated membrane modifications likely influence how Y. pseudotuberculosis interacts with host immune components, potentially explaining the pronounced virulence in immunocompromised patients.

  • Diagnostic Applications: Detection of specific LPS modifications associated with ArnF activity could potentially serve as biomarkers for infection staging or prognostic indicators.

  • Therapeutic Target Development: The critical role of ArnF in bacterial membrane biogenesis makes it a potential target for novel therapeutic approaches, particularly important as antimicrobial resistance continues to rise.

Understanding these clinical implications of ArnF function could ultimately lead to improved diagnostic approaches and treatment strategies for Y. pseudotuberculosis infections, particularly in vulnerable populations such as HIV-positive individuals.

How does temperature regulation affect ArnF expression and function during transition from environmental to host conditions?

The transition of Y. pseudotuberculosis from environmental temperatures (typically around 26°C) to mammalian host temperature (37°C) represents a critical trigger for virulence factor expression and adaptation to the host environment. Research utilizing deep sequencing approaches has revealed significant temperature-dependent changes in the transcriptional landscape of Y. pseudotuberculosis, including differential expression of many small regulatory RNAs between these two temperature conditions .

While the search results don't specifically detail the temperature-dependent regulation of arnF, the broader pattern of temperature-mediated gene expression in Y. pseudotuberculosis suggests that ArnF production and function likely undergo significant changes during host infection. Based on established patterns in related systems, the following temperature-dependent regulatory mechanisms may affect ArnF:

Experimental approaches to investigate temperature-dependent regulation of ArnF should include quantitative RT-PCR analysis of arnF transcript levels, Western blotting with anti-ArnF antibodies, and functional assays of LPS modification at both temperatures. Additionally, studies using reporter fusions to the arnF promoter could identify specific regulatory elements responsible for temperature-dependent expression.

What are the most promising approaches for structure-function studies of ArnF?

Future structure-function studies of ArnF should leverage cutting-edge technological approaches to overcome the challenges inherent in membrane protein research. Several promising directions include:

  • Cryo-Electron Microscopy (Cryo-EM): This rapidly advancing technique offers the potential to determine high-resolution structures of the ArnE-ArnF heterodimeric complex without the need for crystallization. Advances in single-particle analysis now enable resolution approaching 3Å for membrane proteins of similar size. Key approaches should include:

    • Nanodisc or amphipol reconstitution to maintain the native lipid environment

    • Focused refinement techniques to resolve flexible regions

    • Comparison of substrate-bound and substrate-free states to elucidate conformational changes during transport

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This method can map protein dynamics and ligand-induced conformational changes without requiring protein crystals. For ArnF studies, HDX-MS can:

    • Identify substrate binding regions by detecting protection patterns

    • Characterize the interface between ArnE and ArnF subunits

    • Monitor temperature-dependent structural changes relevant to host adaptation

  • Site-Directed Spin Labeling with Electron Paramagnetic Resonance (SDSL-EPR): This approach can determine distances between specific residues in the protein structure, providing valuable constraints for modeling. Application to ArnF would involve:

    • Systematic introduction of cysteine residues for spin label attachment

    • Distance measurements between ArnE and ArnF to map the heterodimer interface

    • Monitoring conformational changes during the substrate translocation cycle

  • Molecular Dynamics Simulations: Computational approaches have become increasingly powerful for studying membrane protein dynamics. For ArnF, simulations could:

    • Model the interaction of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol with the translocation pathway

    • Predict the effects of mutations on protein stability and function

    • Identify potential binding sites for inhibitor development

  • Integrative Structural Biology: Combining multiple experimental approaches (Cryo-EM, NMR, crosslinking mass spectrometry) with computational modeling would provide the most comprehensive view of ArnF structure and function.

These approaches collectively offer the potential to elucidate the molecular mechanisms underlying ArnF-mediated lipid translocation, providing essential insights for antimicrobial development targeting this pathway.

What are the implications of ArnF research for developing novel antimicrobial strategies?

Research on ArnF carries significant implications for novel antimicrobial development strategies, particularly as antibiotic resistance continues to emerge as a global health challenge. As a key component in lipopolysaccharide modification pathways that contribute to antimicrobial resistance, ArnF represents both a potential target for therapeutic intervention and a model for understanding bacterial adaptation mechanisms. Future antimicrobial strategies deriving from ArnF research may include:

  • Direct Inhibition Approaches:

    • Small molecule inhibitors designed to interfere with ArnF-ArnE heterodimer formation

    • Compounds that block the substrate-binding site or translocation channel

    • Peptide-based inhibitors mimicking transmembrane segments to disrupt protein folding or assembly

  • Combination Therapy Strategies:

    • ArnF pathway inhibitors could sensitize resistant Y. pseudotuberculosis to existing antibiotics, particularly polymyxins and other cationic antimicrobial peptides

    • Synergistic combinations targeting both ArnF and other LPS modification pathways could prevent compensatory resistance mechanisms

  • Anti-virulence Approaches:

    • If ArnF contributes to Y. pseudotuberculosis virulence beyond antimicrobial resistance, inhibitors could reduce pathogenicity without creating strong selective pressure for resistance

    • Targeting the regulatory pathways controlling arnF expression could attenuate virulence during infection

  • Broad-spectrum Applications:

    • Given the conservation of ArnF across many Gram-negative pathogens, inhibitors could potentially address multiple bacterial threats

    • Comparative analysis of ArnF structural differences between species could guide development of selective or broad-spectrum inhibitors

  • Diagnostic and Surveillance Tools:

    • Understanding ArnF-mediated resistance mechanisms could inform the development of diagnostic tests to rapidly identify resistant strains

    • Monitoring arnF genetic variations could help track the emergence and spread of resistant phenotypes

The clinical significance of this approach is underscored by the documented cases of Y. pseudotuberculosis septicemia in immunocompromised patients and the ongoing challenges in treating infections caused by Gram-negative pathogens. By targeting fundamental mechanisms of bacterial membrane modification that contribute to both virulence and antibiotic resistance, ArnF-focused antimicrobial strategies could address a critical need in infectious disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.