Recombinant Yersinia pseudotuberculosis serotype O:1b Probable intracellular septation protein A (YpsIP31758_1944)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
yciB; YpsIP31758_1944; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
YpsIP31758_1944
Target Protein Sequence
MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRMLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.

Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YpsIP31758_1944 and what is its predicted function?

YpsIP31758_1944 is a probable intracellular septation protein A from Yersinia pseudotuberculosis serotype O:1b. It is also known as yciB or inner membrane-spanning protein YciB with a UniProt ID of A7FI41. As a putative septation protein, it likely plays a role in bacterial cell division processes. The full-length protein consists of 180 amino acids and contains a hydrophobic transmembrane domain structure, suggesting its localization to the bacterial inner membrane . Based on homology with other bacterial septation proteins, it may be involved in coordinating cell envelope constriction during bacterial division, though its precise molecular function in Y. pseudotuberculosis has not been fully characterized.

How does YpsIP31758_1944 compare to homologous proteins in other bacterial species?

Unlike some other Yersinia virulence factors, YpsIP31758_1944 is not a known component of the type III secretion system (T3SS) or an injected effector protein like Yersinia outer proteins (Yops) . This suggests its primary role may be in bacterial cell physiology rather than direct host manipulation, though this doesn't exclude potential indirect effects on pathogenesis through its role in bacterial division or membrane integrity.

What are the challenges in expressing and purifying full-length YpsIP31758_1944?

Expression and purification of YpsIP31758_1944 present several significant challenges due to its nature as a transmembrane protein:

  • Membrane Protein Solubility: As an inner membrane protein with multiple hydrophobic domains, YpsIP31758_1944 is inherently difficult to solubilize while maintaining its native conformation . Researchers must carefully optimize detergent selection and concentration to extract the protein without denaturation.

  • Expression Host Considerations: While E. coli is commonly used for recombinant expression, overexpression of membrane proteins can lead to toxicity, inclusion body formation, or improper folding . The current recombinant form utilizes His-tagging and E. coli expression, but yields may be limited by membrane insertion capacity.

  • Purification Strategy Optimization: Multi-step purification protocols are typically required, often combining immobilized metal affinity chromatography (due to the His-tag) with size exclusion chromatography. Maintaining protein stability throughout the purification process requires careful buffer optimization with appropriate detergents or membrane-mimetic systems .

  • Protein Quality Assessment: Verifying the correct folding and functional state of purified YpsIP31758_1944 is challenging since standard activity assays for septation proteins are not well-established. Researchers must rely on biophysical characterization and functional reconstitution experiments.

How might YpsIP31758_1944 contribute to Yersinia pathogenesis mechanisms?

While YpsIP31758_1944 is not a known virulence effector like Yops proteins, its role in bacterial cell division could indirectly impact pathogenesis through several potential mechanisms:

  • Bacterial Survival Within Host Cells: Y. pseudotuberculosis, like related Y. pestis, can survive within macrophages by establishing specialized compartments. Proper bacterial cell division, potentially mediated by YpsIP31758_1944, may be crucial for adaptation to the intracellular environment .

  • Coordination with Virulence Systems: Cell division and membrane organization may be coordinated with the expression and assembly of virulence machinery such as the injectisome complex . Septation proteins could potentially influence the spatial organization or assembly efficiency of these systems.

  • Stress Response and Antibiotic Resistance: Septation proteins often function in bacterial stress responses. YpsIP31758_1944 might contribute to bacterial persistence under host-induced stress conditions or antibiotic pressure.

  • Potential Interactions with Host Factors: Though primarily involved in bacterial processes, the protein's localization to the bacterial membrane places it at the bacteria-host interface, where it could potentially interact with host factors or be recognized by host immune surveillance mechanisms.

Further research using genetic approaches such as deletion mutants and complementation studies would be necessary to define the precise contribution of YpsIP31758_1944 to Yersinia virulence and host-pathogen interactions.

What are current research gaps regarding YpsIP31758_1944 function and interaction partners?

Several significant knowledge gaps exist in our understanding of YpsIP31758_1944:

  • Molecular Function: While classified as a probable septation protein, the precise biochemical activity and molecular mechanism of YpsIP31758_1944 remain unclear. Does it function as an enzyme, a structural protein, or a regulator of other divisome components?

  • Interaction Network: The protein-protein interaction partners of YpsIP31758_1944 within the Y. pseudotuberculosis divisome complex have not been comprehensively mapped. Identifying these interactions could provide insights into its function and regulation.

  • Regulation During Infection: How expression and activity of YpsIP31758_1944 are regulated during different stages of infection remains unexplored. Does its expression change in response to host environments or stress conditions?

  • Structural Information: The three-dimensional structure of YpsIP31758_1944 has not been determined experimentally, limiting our understanding of its functional domains and potential binding interfaces.

  • Potential as Therapeutic Target: Given the essential nature of bacterial cell division, YpsIP31758_1944 could represent a potential antimicrobial target, but its druggability and essentiality in Y. pseudotuberculosis have not been established.

Addressing these knowledge gaps would require interdisciplinary approaches combining structural biology, genetic manipulation, and advanced imaging techniques.

What are the optimal conditions for reconstitution and storage of recombinant YpsIP31758_1944?

Optimal handling of recombinant YpsIP31758_1944 requires careful attention to buffer composition and storage conditions:

Reconstitution Protocol:

  • Centrifuge the lyophilized protein vial briefly to collect the powder at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (or between 5-50% based on experimental requirements)

  • Mix gently until completely dissolved, avoiding excessive agitation that could denature the protein

Storage Recommendations:

  • For long-term storage: Aliquot the reconstituted protein and store at -20°C/-80°C

  • For working solutions: Store at 4°C for no more than one week

  • Avoid repeated freeze-thaw cycles as these significantly reduce protein activity

  • Working buffer should maintain pH 8.0 using Tris/PBS-based system with 6% trehalose

Stability Considerations:
The membrane protein nature of YpsIP31758_1944 makes it particularly sensitive to storage conditions. Researchers should verify protein integrity before use through methods such as SDS-PAGE or western blotting, especially after extended storage periods.

What experimental approaches could elucidate the function of YpsIP31758_1944 in bacterial cell division?

Several complementary experimental approaches could be employed to investigate YpsIP31758_1944 function:

Genetic Manipulation Approaches:

  • Gene Deletion and Complementation: Construct a ΔYpsIP31758_1944 knockout strain and characterize its phenotype, particularly regarding cell morphology, division rate, and virulence. Complementation with wild-type or mutant versions could confirm phenotype specificity.

  • Conditional Expression Systems: For essential genes, tetracycline-inducible or similar systems allow controlled depletion of the protein to observe resultant phenotypes.

Localization and Interaction Studies:

  • Fluorescent Protein Fusions: C-terminal or N-terminal fusions with fluorescent proteins (considering the transmembrane topology) could reveal the dynamic localization of YpsIP31758_1944 during the cell cycle.

  • Co-immunoprecipitation and Bacterial Two-Hybrid Assays: These approaches could identify interaction partners within the divisome complex.

Functional Characterization:

  • Membrane Fractionation: Biochemical fractionation followed by western blotting could confirm the membrane localization and potential association with specific membrane domains.

  • In vitro Reconstitution: Purified YpsIP31758_1944 could be incorporated into liposomes or nanodiscs to study its behavior in defined membrane environments.

  • Structural Studies: X-ray crystallography or cryo-EM of the protein in detergent micelles or lipid nanodiscs could provide crucial structural insights.

These approaches should be combined with phenotypic assays measuring growth rates, cell morphology, and response to division-inhibiting antibiotics to build a comprehensive understanding of YpsIP31758_1944 function.

How can researchers differentiate between the direct effects of YpsIP31758_1944 and indirect consequences on bacterial pathogenesis?

Distinguishing direct from indirect effects of YpsIP31758_1944 on pathogenesis requires carefully designed experimental approaches:

Separation of Growth and Virulence Phenotypes:

  • Growth Rate Normalization: When comparing wild-type and mutant strains in virulence assays, normalize for potential differences in growth rates to isolate virulence-specific effects.

  • Inducible Expression Systems: Use tightly controlled induction systems that allow expression of YpsIP31758_1944 at defined time points during infection to separate establishment from persistence effects.

Mechanistic Dissection:

  • Domain Mapping: Generate point mutations or truncations that separate different functions of the protein to determine which domains are essential for division versus potential pathogenesis-related activities.

  • Host Response Analysis: Compare host transcriptional and cellular responses to wild-type versus ΔYpsIP31758_1944 mutants to identify specific host pathways affected.

Integrative Approaches:

  • Multi-omics Analysis: Combine transcriptomics, proteomics, and metabolomics to build a systems-level understanding of the consequences of YpsIP31758_1944 deletion.

  • Mathematical Modeling: Develop predictive models that incorporate both bacterial cell division parameters and host-pathogen interaction variables to deconvolute direct and indirect effects.

  • Comparative Studies: Examine the effect of YpsIP31758_1944 deletion across different infection models and host cell types to identify context-dependent versus universal effects.

The complexity of bacterial pathogenesis necessitates these multi-faceted approaches to accurately attribute phenotypes to specific molecular mechanisms.

How does YpsIP31758_1944 compare to other Yersinia virulence factors in terms of conservation and function?

YpsIP31758_1944 differs significantly from classical Yersinia virulence factors in several key aspects:

FeatureYpsIP31758_1944Classical Virulence Factors (e.g., Yops)
Genetic LocationChromosomally encodedOften plasmid-encoded (pYV)
ConservationHighly conserved across Yersinia species and other enterobacteriaMore variable, often specific to pathogenic Yersinia
Delivery MechanismNot secreted, integral membrane proteinTypically delivered via T3SS to host cells
Primary FunctionBacterial cell physiology (septation)Direct modulation of host cell processes
Evolutionary PressureConserved due to essential cellular functionRapidly evolving due to host-pathogen arms race

What insights can structural predictions provide about YpsIP31758_1944 function?

Structural bioinformatics approaches can provide valuable insights into YpsIP31758_1944 function despite the absence of experimental structures:

Transmembrane Topology Prediction:
Analysis of the amino acid sequence reveals multiple putative transmembrane helices, consistent with its classification as an inner membrane protein. The arrangement of these helices likely creates a specific three-dimensional fold within the membrane that is critical for its function in septation .

Conserved Domains and Motifs:
The protein contains sequence patterns characteristic of the YciB family, including conserved charged residues at predicted membrane-cytoplasm interfaces that may mediate interactions with other divisome components or serve as recognition sites for regulatory proteins.

Structural Homology Modeling:
Though experimental structures are lacking, homology modeling based on related proteins suggests YpsIP31758_1944 may form a compact transmembrane bundle. The protein might undergo conformational changes coordinated with the cell division cycle, potentially creating interaction surfaces that are exposed only at specific stages of septation.

Functional Predictions:
The structural features suggest several possible functions:

  • A channel or transporter involved in peptidoglycan precursor translocation

  • A scaffold protein that recruits other divisome components

  • A sensor that detects membrane curvature or tension during division

Advanced structural prediction methods combining evolutionary information with AI-based approaches could further refine these models and generate testable hypotheses about YpsIP31758_1944 function .

What emerging technologies could advance our understanding of YpsIP31758_1944?

Several cutting-edge technologies show promise for elucidating YpsIP31758_1944 function and interactions:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy: Particularly single-particle analysis and tomography, which have revolutionized membrane protein structural determination without the need for crystallization.

  • Integrative Structural Biology: Combining multiple experimental data sources (crosslinking mass spectrometry, HDX-MS, SAXS) with computational modeling to determine structure in native-like environments.

High-Resolution Imaging Techniques:

  • Super-Resolution Microscopy: Techniques like PALM, STORM, or STED microscopy could visualize YpsIP31758_1944 localization during cell division with nanometer precision.

  • Correlative Light and Electron Microscopy (CLEM): Combining the specificity of fluorescence labeling with the ultrastructural detail of electron microscopy to contextualize protein localization.

Systems-Level Analysis:

  • Bacterial Interactomics: Comprehensive protein-protein interaction mapping using BioID or APEX proximity labeling adapted for bacterial systems.

  • Transposon Sequencing (Tn-Seq): To identify synthetic lethal or synthetic sick interactions with YpsIP31758_1944, revealing functional relationships.

Innovative Genetic Tools:

  • CRISPR Interference (CRISPRi): For controlled and titratable gene repression to study the effects of partial protein depletion.

  • Optogenetic Control Systems: Light-inducible protein degradation or activation systems to manipulate YpsIP31758_1944 with spatiotemporal precision.

These technologies, especially when applied in combination, could dramatically accelerate our understanding of this important bacterial protein and potentially reveal novel antimicrobial targets.

How might understanding YpsIP31758_1944 contribute to novel therapeutic approaches?

Research on YpsIP31758_1944 could contribute to antimicrobial development through several pathways:

Target-Based Drug Discovery:
If YpsIP31758_1944 proves essential for Y. pseudotuberculosis viability or virulence, it could become a direct target for novel antibiotics. Its membrane localization and likely essential function in cell division make it potentially druggable, similar to how β-lactam antibiotics target cell wall synthesis.

Pathogenesis Intervention:
Understanding how YpsIP31758_1944 contributes to bacterial adaptation within host environments could reveal strategies to compromise bacterial survival without directly targeting the protein. This might involve disrupting downstream processes that depend on proper septation.

Broad-Spectrum Applications:
Due to the conservation of YciB family proteins across bacterial species, insights gained from studying YpsIP31758_1944 might be applicable to other important pathogens, potentially leading to broad-spectrum therapeutic approaches targeting bacterial cell division.

Combination Therapy Approaches:
Knowledge of YpsIP31758_1944 function could inform rational combination therapies that simultaneously target cell division and virulence mechanisms, reducing the likelihood of resistance development.

The rising threat of antimicrobial resistance makes research into fundamental bacterial processes like cell division increasingly important for public health. YpsIP31758_1944 represents one component of this essential machinery that deserves further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.