Recombinant Yersinia pseudotuberculosis serotype O:1b Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; YpsIP31758_0273; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLSNRHKDKSLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGGALETW FDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILPIIKADVRLMYRLAGWVPKLL PDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRESVL VMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP HDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHVDSGWVPRDTNVEDFEF AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELPELVYDSLQQHKLLQQS VEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTILFLADATEVSTGFIVAGALAWFIGWR RTC
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis and what is its relationship to other Yersinia species?

Yersinia pseudotuberculosis is a gram-negative bacterium belonging to the Yersinia genus. It is the closest ancestor of Yersinia pestis (the causative agent of plague), sharing >90% genetic identity based on nucleotide sequence comparison and approximately 75% protein amino acid sequence identity . Y. pseudotuberculosis shows greater genetic stability with fewer insertion sequences than Y. pestis and has a broader host range including rodents, dogs, cats, cattle, rabbits, deer, and humans . All three major pathogenic Yersinia species (Y. pestis, Y. enterocolitica, and Y. pseudotuberculosis) share approximately 73% genetic identity and contain similar virulence plasmids (pCD1/pYV) encoding type three secretion systems (T3SS) .

What is the function of ubiquinone biosynthesis protein UbiB in bacterial systems?

The UbiB protein in Y. pseudotuberculosis serotype O:1b is classified as a probable ubiquinone biosynthesis protein. Ubiquinone (also known as coenzyme Q) is an essential component of the electron transport chain in bacterial respiration. The UbiB protein plays a crucial role in the biosynthetic pathway of ubiquinone, contributing to energy metabolism in the bacterium.

Based on sequence analysis, the full amino acid sequence of UbiB from Y. pseudotuberculosis serotype O:1b (strain IP 31758) consists of 543 amino acids . The protein contains several conserved domains typical of UbiB family proteins, which are involved in aerobic respiration and oxidative stress response, making it essential for bacterial survival under various environmental conditions.

What are the optimal conditions for expression of recombinant UbiB protein?

The expression of recombinant UbiB protein from Y. pseudotuberculosis requires careful optimization of conditions to maximize yield while maintaining protein functionality. The following methodology has proven effective:

Expression System Selection:

  • E. coli BL21(DE3) strain is recommended for expression due to its reduced protease activity

  • pET-based vectors with T7 promoter systems provide controlled induction

Optimization Parameters:

ParameterRecommended RangeNotes
Temperature16-25°CLower temperatures reduce inclusion body formation
Induction time4-16 hoursExtended time at lower temperatures improves folding
IPTG concentration0.1-0.5 mMLower concentrations favor soluble protein
MediaLB or TBTB provides higher biomass for increased yield
OD600 at induction0.6-0.8Mid-log phase provides optimal expression balance

Solubility Enhancement:

  • Addition of 1% glucose to growth media can repress basal expression

  • Co-expression with chaperones (GroEL/GroES) may improve folding

  • Fusion tags such as MBP or SUMO can increase solubility

What are the most effective methods for purification of recombinant UbiB protein?

Purification of recombinant UbiB protein presents several challenges due to its membrane association properties. A multi-step purification protocol is recommended:

  • Cell Lysis Optimization:

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

    • Addition of mild detergents (0.5-1% Triton X-100 or 0.5% CHAPS) aids in solubilization

    • Inclusion of protease inhibitors prevents degradation

  • Affinity Chromatography:

    • His-tagged constructs can be purified using Ni-NTA resin

    • Washing with increasing imidazole concentrations (10-40 mM) removes non-specific binding

    • Elution with 250-300 mM imidazole yields relatively pure protein

  • Secondary Purification:

    • Ion exchange chromatography (IEX) using Q-Sepharose at pH 8.0

    • Size exclusion chromatography (SEC) for removing aggregates and oligomers

  • Quality Assessment:

    • SDS-PAGE analysis for purity determination

    • Western blotting with anti-UbiB antibodies for identity confirmation

    • Dynamic light scattering (DLS) for homogeneity evaluation

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage to maintain stability .

What immunological methods are suitable for detection of UbiB protein?

Several immunological techniques can be employed for specific detection of UbiB protein in research applications:

Antibody Selection:
Various anti-Yersinia antibodies are commercially available that may cross-react with UbiB protein based on epitope conservation . Custom antibodies against specific UbiB epitopes can be developed for higher specificity.

Western Blot Protocol:

  • Separate proteins using 10-12% SDS-PAGE

  • Transfer to PVDF membrane (25V, overnight at 4°C for optimal transfer)

  • Block with 5% non-fat milk in TBST for 1 hour

  • Incubate with primary antibody at 1:1000-1:5000 dilution

  • Detect using appropriate HRP-conjugated secondary antibody and chemiluminescence

ELISA Methods:

  • Direct coating of purified UbiB protein (1-10 μg/ml) onto high-binding plates

  • Indirect sandwich ELISA using capture and detection antibodies

  • Competitive ELISA for quantitative analysis

Anti-UbiB antibodies can be used for multiple applications including Western blotting, ELISA, and immunofluorescence techniques . For highest specificity, recombinant antibody approaches such as those used for other Yersinia proteins may be adapted for UbiB detection .

How can UbiB be targeted for structure-function studies?

Understanding the structure-function relationship of UbiB protein requires sophisticated experimental approaches:

Site-Directed Mutagenesis Strategy:

  • Identify conserved residues through multiple sequence alignment with UbiB homologs

  • Generate alanine-scanning mutants of key residues in the full-length sequence

  • Evaluate functional consequences through activity assays

  • The complete amino acid sequence provided for Y. pseudotuberculosis UbiB can guide targeting of specific domains

Structural Analysis Methods:

  • X-ray crystallography (challenges include protein crystallization)

  • Cryo-electron microscopy for native conformation analysis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

Functional Domain Mapping:
The 543-amino acid sequence of UbiB contains multiple functional domains that can be systematically analyzed through truncation constructs and domain swapping experiments .

What is the role of UbiB in Yersinia virulence and pathogenicity?

The contribution of UbiB to Y. pseudotuberculosis virulence involves complex mechanisms related to energy metabolism and stress response:

Infection Models for Assessment:

  • In vivo models using Swiss Webster mice can be used to study bacterial persistence in tissues similar to studies with other Y. pseudotuberculosis strains

  • Measurement of bacterial loads in Peyer's patches, liver, spleen, and lungs at 3, 6, and 9 days post-infection provides insights into dissemination patterns

Virulence Assessment Methodology:

  • Generate ubiB deletion mutants using allelic exchange techniques

  • Compare wild-type and ΔubiB mutant colonization in tissue culture infections

  • Evaluate persistence in mouse models using methods described for other Y. pseudotuberculosis virulence studies

  • Assess impact on T3SS function, as the T3SS is a critical virulence determinant in Yersinia

Y. pseudotuberculosis can be engineered with specific mutations to study virulence. For instance, studies with triple mutation strains (Δ yopK Δ yopJ Δ asd) have shown altered colonization patterns in mouse tissues compared to wild-type strains . Similar approaches could be applied to study UbiB's role in pathogenesis.

How does UbiB interact with other components of the ubiquinone biosynthesis pathway?

Understanding the protein-protein interactions of UbiB requires targeted investigation:

Interaction Analysis Techniques:

  • Bacterial two-hybrid screening to identify potential interaction partners

  • Co-immunoprecipitation followed by mass spectrometry analysis

  • Surface plasmon resonance (SPR) for kinetic analysis of specific interactions

  • FRET-based approaches for in vivo interaction studies

Metabolic Impact Assessment:

  • Metabolomics analysis comparing wild-type and ubiB mutants

  • Quantification of ubiquinone intermediates using HPLC-MS/MS

  • Isotope labeling studies to track metabolic flux through the pathway

Gene Expression Analysis:

  • RNA-Seq to identify genes co-regulated with ubiB

  • ChIP-Seq to identify potential transcriptional regulators of ubiB

  • qRT-PCR validation of key regulatory relationships

Can UbiB protein be used in vaccine development against Yersinia infections?

The potential of UbiB as a vaccine candidate can be evaluated through systematic immunological studies:

Antigen Presentation Strategy:
Y. pseudotuberculosis has been successfully used as a delivery vehicle for vaccine antigens against plague and yersiniosis. For example, a recombinant attenuated Y. pseudotuberculosis strain (χ10069) has been used to deliver Y. pestis fusion proteins as protective antigens . Similar approaches could be developed for UbiB-based vaccines.

Immunization Protocol Design:

  • Evaluate different delivery systems (recombinant protein with adjuvants, DNA vaccines, live attenuated vectors)

  • Determine optimal dosing and boosting schedules

  • Assess different routes of administration (oral, intranasal, subcutaneous)

Oral vaccination studies with Y. pseudotuberculosis strains have demonstrated the development of both systemic and mucosal immune responses, with significant anti-antigen IgG titers in sera peaking around day 14 post-immunization . This approach could be adapted for UbiB-based vaccine development.

What methods can detect UbiB-specific immune responses in experimental models?

Characterization of immune responses to UbiB requires comprehensive immunological assays:

Humoral Immunity Assessment:

  • ELISA for detection of UbiB-specific antibodies (IgG, IgA, IgM)

  • Isotype profiling to determine IgG1, IgG2a, and IgG2b ratios

  • Avidity assays using chaotropic agents to evaluate antibody maturation

Cellular Immunity Analysis:

  • ELISpot assays for enumeration of cytokine-secreting cells

  • Intracellular cytokine staining for identification of T cell subsets

  • Proliferation assays to assess antigen-specific T cell expansion

Studies with Y. pseudotuberculosis vaccine strains have demonstrated mixed IgG1 and IgG2a/IgG2b serum antibody responses, indicating coinduction of Th1- and Th2-mediated immune responses . Similar immune profiling could be applied to UbiB immunization studies.

How conserved is UbiB across different Yersinia species and strains?

Understanding the evolutionary conservation of UbiB provides insights into its functional importance:

Comparative Analysis Methodology:

  • Retrieve UbiB sequences from different Yersinia species and strains

  • Perform multiple sequence alignment using tools like MUSCLE or Clustal Omega

  • Calculate sequence identity and similarity percentages

  • Identify conserved domains and variable regions

Phylogenetic Analysis:

  • Construct maximum likelihood phylogenetic trees

  • Map UbiB evolution against species divergence

  • Identify potential horizontal gene transfer events

Y. pseudotuberculosis and Y. pestis share >90% genetic identity, with approximately 75% protein amino acid sequence identity . Analysis of UbiB conservation within this context can provide insights into its evolutionary importance and potential as a species-specific or conserved target.

What analytical methods are used to study UbiB function in ubiquinone biosynthesis?

Functional characterization of UbiB requires specialized biochemical techniques:

Enzymatic Activity Assays:

  • Development of in vitro reconstitution systems with purified components

  • Spectrophotometric assays monitoring substrate consumption or product formation

  • Coupled enzyme assays for indirect measurement of activity

Structural Characterization:

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

  • Nuclear magnetic resonance (NMR) for solution structure determination

  • Homology modeling based on related proteins with known structures

In Vivo Function Analysis:

  • Complementation studies in ubiB deletion strains

  • Metabolic labeling to track ubiquinone biosynthesis

  • Growth phenotyping under various stress conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.