Recombinant Yersinia pseudotuberculosis serotype O:1b Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Structure and Function

  • Primary Sequence: The full-length recombinant Lgt protein (UniProt: A7FFD9) spans 290 amino acids (AA 1–290) with a molecular weight of approximately 30–35 kDa. The sequence includes conserved motifs for diacylglycerol transferase activity .

  • Enzymatic Role: Lgt catalyzes the transfer of diacylglycerol groups to the N-terminal cysteine residue of prelipoproteins, enabling their retention in the bacterial membrane. This process is vital for lipoprotein maturation and bacterial viability .

  • EC Classification: EC=2.4.99.- (glycosyltransferases), though its role in lipid transfer suggests potential reclassification under lipid-modifying enzymes.

FeatureDetail
Gene Namelgt
Species/StrainYersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Expression Region1–290 amino acids
Purity>90% (MyBiosource)
Storage BufferTris-based buffer with 50% glycerol

Expression Systems

  • Host Organism: Escherichia coli (e.g., Rosetta (DE3) strain) .

  • Vector: Cloned into plasmids like pET-40b(+) for soluble expression .

  • Induction Parameters: IPTG concentration (e.g., 0.2 mM) and low-temperature cultivation (14°C overnight) optimize solubility .

Quality Control

  • Storage Conditions: -20°C or -80°C for long-term stability; avoid repeated freeze-thaw cycles .

  • Applications: Used in ELISA assays, structural studies, and pathogenesis research .

Role in Bacterial Membrane Integrity

  • Lipoprotein Retention: Lgt-deficient mutants release unmodified prelipoproteins into the extracellular environment, compromising membrane stability and immune evasion .

  • Immune Modulation: Lipoproteins in Y. pseudotuberculosis interact with host receptors (e.g., TLR2), but unlipidated lipoproteins may fail to trigger inflammatory responses .

Impact on Virulence

  • Type III Secretion System (T3SS): Lgt may indirectly support T3SS function by maintaining membrane integrity, as T3SS components (e.g., Yops) require functional membranes for secretion .

  • Outer Membrane Vesicles (OMVs): Engineered Y. pseudotuberculosis strains with enhanced OMV production (e.g., ΔlpxL mutants) rely on membrane stability, potentially involving Lgt for lipoprotein processing .

Comparative Analysis with Other Bacteria

OrganismLgt FunctionImpact of Deletion
Y. pseudotuberculosisLipidation of prelipoproteinsReduced membrane integrity, immune evasion
Staphylococcus aureusLipoprotein maturationLeaked prelipoproteins, diminished virulence
E. coliLipidation of prelipoproteinsAltered membrane protein biogenesis

Diagnostic Tools

  • ELISA Antigens: Recombinant Lgt serves as a diagnostic marker for Y. pseudotuberculosis infections, though its use is limited compared to other antigens like OmpF .

Vaccine Development

  • OMV-Based Vaccines: Engineered Y. pseudotuberculosis strains producing OMVs (e.g., ΔlpxL mutants) are explored as vaccine candidates against plague, leveraging Lgt for membrane stability .

Mechanistic Studies

  • Immune Evasion: Chromosomal toxins (e.g., CNFY) and plasmid-encoded T3SS effectors in Y. pseudotuberculosis synergize with Lgt-dependent lipoproteins to suppress phagocytosis .

Key Research Findings

  1. Immune Activation: lgt mutants in S. aureus induce weaker cytokine responses (e.g., IL-6, IL-8) compared to wild-type strains, highlighting Lgt’s role in immune modulation .

  2. OMV Production: Deletion of lpxL in Y. pseudotuberculosis increases OMV yield, suggesting Lgt’s indirect role in membrane curvature and vesicle formation .

  3. T3SS Regulation: RpoN and GlrR regulate T3SS in Y. pseudotuberculosis, potentially interacting with Lgt to maintain membrane integrity during effector secretion .

Future Directions

  • Enzyme Kinetics: Characterization of Lgt’s substrate specificity and catalytic efficiency.

  • Structural Biology: X-ray crystallography to resolve Lgt’s binding pocket and mechanism.

  • Therapeutic Targets: Inhibiting Lgt to disrupt lipoprotein biogenesis in Y. pseudotuberculosis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
lgt; YpsIP31758_0983; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAMLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of lgt in Yersinia pseudotuberculosis serotype O:1b?

Prolipoprotein diacylglyceryl transferase (lgt) in Y. pseudotuberculosis is part of the lipoprotein biosynthesis pathway. While not directly located within the O-antigen gene cluster, it plays a crucial role in bacterial membrane integrity and pathogenesis. The O-antigen gene clusters in Y. pseudotuberculosis are typically located between the hemH and gsk genes, with O:1b being particularly significant as it represents the serotype from which Y. pestis is believed to have emerged . Y. pestis carries genes for the O:1b serotype but contains inactivating mutations in four O-antigen genes, resulting in no O-antigen production . When studying lgt in Y. pseudotuberculosis O:1b, researchers should consider how it interacts with these serotype-specific genetic elements.

Methodologically, genomic characterization of lgt requires:

  • Whole genome sequencing of Y. pseudotuberculosis O:1b strains

  • Comparative genomic analysis with related Yersinia species

  • PCR amplification and sequencing of the lgt gene and flanking regions

  • Gene expression analysis under different growth conditions

How does lgt contribute to Y. pseudotuberculosis virulence mechanisms?

Prolipoprotein diacylglyceryl transferase catalyzes a critical step in bacterial lipoprotein biosynthesis by transferring a diacylglyceryl moiety to prolipoprotein substrates. In Y. pseudotuberculosis, properly processed lipoproteins likely contribute to several virulence mechanisms. The bacterium employs multiple strategies to evade host immune responses, including both plasmid-encoded Yersinia outer proteins of the Type III secretion system and chromosome-encoded protein toxins . Though not specifically mentioned in the search results as being involved in immune evasion, lgt-processed lipoproteins would logically play roles in:

  • Maintaining membrane integrity during infection

  • Contributing to bacterial colonization of lymphoid organs

  • Potentially modulating interactions with host immune cells

  • Supporting bacterial survival in macrophages

Research approaches to investigate these functions include:

  • Construction of lgt deletion mutants in Y. pseudotuberculosis O:1b

  • Comparative proteomics of wild-type and lgt mutant strains

  • Infection models examining colonization and dissemination capabilities

  • Analysis of interactions with various host immune cells

How do structural features of lgt in Y. pseudotuberculosis O:1b compare to those in other bacterial pathogens?

While the search results don't provide specific structural information about lgt in Y. pseudotuberculosis O:1b, researchers investigating this question would typically:

  • Perform multiple sequence alignments of lgt from various bacterial species

  • Identify conserved catalytic domains and species-specific regions

  • Utilize structural prediction software to model the protein

  • Consider phylogenetic relationships to understand evolutionary patterns

Given that Y. pseudotuberculosis O:1b is evolutionarily significant as the progenitor of Y. pestis , comparative analysis between these species could reveal important structural and functional adaptations of lgt.

What experimental approaches are most effective for expressing and purifying recombinant Y. pseudotuberculosis O:1b lgt for structural studies?

For researchers aiming to conduct structural studies of recombinant Y. pseudotuberculosis O:1b lgt, several methodological considerations are crucial:

Expression Systems:

  • E. coli BL21(DE3) or derivatives - Most commonly used but may require optimization for membrane proteins

  • Cell-free expression systems - Useful for toxic or membrane proteins

  • Yeast expression systems - For proteins requiring eukaryotic post-translational modifications

Purification Strategy:

  • Affinity chromatography using His-tag or other fusion tags

  • Detergent screening for optimal membrane protein solubilization

  • Size exclusion chromatography for final polishing

Challenges and Solutions:

  • Membrane protein expression can be toxic to host cells; consider using inducible systems with tight regulation

  • Protein folding issues may be addressed using chaperone co-expression

  • For structural studies, protein stability can be enhanced by ligand addition or engineering thermostable variants

Researchers should validate the functionality of purified recombinant lgt through activity assays that measure the transfer of diacylglyceryl moieties to substrate prolipoproteins.

How can signature-tagged mutagenesis be optimized to study lgt function in Y. pseudotuberculosis O:1b infection models?

Signature-tagged mutagenesis (STM) has proven effective for identifying Y. pseudotuberculosis genes essential for survival in vivo . For studying lgt specifically:

Methodological Approach:

  • Generate a library of tagged transposon mutants in Y. pseudotuberculosis O:1b, ensuring coverage of the lgt gene

  • Inoculate mice orally with pools of tagged mutants

  • Recover bacteria from cecum, mesenteric lymph nodes, and spleen at various timepoints

  • Identify missing tags to determine mutants attenuated in colonization or dissemination

Optimization Strategies:

  • Use smaller pools (15-20 mutants) to avoid competition effects

  • Include known attenuated mutants as controls (e.g., type III secretion system mutants)

  • Employ recombination-based approaches for creating clean deletions in lgt

  • Utilize conditional mutants if lgt is essential for in vitro growth

Data Analysis:

  • Compare colonization patterns at multiple infection sites to identify tissue-specific requirements

  • Consider the barriers that limit bacterial progression to deeper tissues

  • Validate results with individual infection experiments using targeted mutants

What are the implications of O-antigen structure on recombinant lgt activity in Y. pseudotuberculosis O:1b?

The O-antigen structure significantly impacts bacterial surface properties and host interactions. For Y. pseudotuberculosis O:1b specifically:

Research Considerations:

  • The O:1b antigen has a specific structure that could affect membrane protein localization and function

  • O-antigen mutants show reduced ability to invade epithelial cells , which might alter the accessibility or function of membrane-associated lgt

  • Y. pseudotuberculosis O:1b is closely related to strains that caused Far East scarlet-like fever

Experimental Approaches:

  • Compare lgt activity in wild-type O:1b strains versus defined O-antigen mutants

  • Analyze membrane protein topology and localization with and without intact O-antigen

  • Examine how lipid composition affects lgt enzyme kinetics

  • Investigate potential interactions between lgt-processed lipoproteins and O-antigen components

How can researchers address conflicting data regarding lgt essentiality in Y. pseudotuberculosis O:1b?

When faced with contradictory results regarding lgt essentiality:

Analytical Framework:

  • Examine differences in experimental conditions (temperature, media, growth phase)

  • Consider strain variations and genetic backgrounds

  • Evaluate the methods used to determine essentiality:

    • Transposon mutagenesis may miss essential genes due to technical limitations

    • Conditional mutants might reveal context-dependent essentiality

    • Complementation studies can confirm causality

Resolution Approach:

  • Employ CRISPRi for partial knockdown to assess dose-dependent effects

  • Use different animal models to test host-specific essentiality

  • Construct conditional mutants with tunable expression

  • Perform comprehensive suppressor screens to identify compensatory mechanisms

What statistical methods are most appropriate for analyzing lgt contributions to bacterial colonization across different tissues?

When analyzing data from infection experiments:

Statistical Considerations:

  • Use non-parametric tests when data doesn't follow normal distribution (common in bacterial counts)

  • Apply mixed-effects models for longitudinal studies with multiple timepoints

  • Consider multiple testing corrections for experiments examining multiple organs

  • Use robust statistics to handle outliers common in biological systems

Data Representation:

Analysis TypeRecommended TestApplication Scenario
Between-group comparisonMann-Whitney UComparing wild-type vs. lgt mutant in single tissue
Multi-tissue comparisonKruskal-Wallis with post-hocComparing colonization across cecum, MLN, and spleen
Correlation analysisSpearman's rankRelating lgt expression to colonization levels
Survival analysisLog-rank testComparing time-to-death in infection models

Researchers should validate results through biological replicates and control for variables such as inoculum size, animal health status, and genetic background.

How does lgt contribute to Y. pseudotuberculosis O:1b immune evasion strategies?

Y. pseudotuberculosis employs sophisticated mechanisms to modulate host immune responses, with both plasmid and chromosome-encoded factors playing roles . Future research on lgt's contribution should address:

Key Research Questions:

  • Does lgt process lipoproteins involved in macrophage polarization toward the M2 phenotype?

  • How do lgt-processed lipoproteins interact with the Type III secretion system?

  • What is the relationship between lgt activity and bacterial survival in phagocytes?

Methodological Approaches:

  • Transcriptomics and proteomics of host cells infected with wild-type versus lgt mutants

  • Identification of specific lgt substrates involved in immune modulation

  • Single-cell analysis of infected versus uninfected immune cells

  • In vivo imaging to track bacterial dissemination and immune cell recruitment

What emerging technologies could advance our understanding of lgt function in Y. pseudotuberculosis O:1b?

Several cutting-edge technologies offer promise for deeper insights:

Emerging Methodologies:

  • CRISPR-Cas9 genome editing for precise genetic manipulation

  • Cryo-electron microscopy for structural determination of membrane-embedded lgt

  • Proximity labeling approaches (BioID, APEX) to identify interaction partners

  • Single-cell RNA sequencing of infected host tissues

  • Mass spectrometry-based lipidomics to characterize the lipid modifications

Integration of Multiple Approaches:
Combining structural biology, genetics, and infection models will provide comprehensive understanding of lgt function. The most promising strategy is likely a systems biology approach that integrates:

  • Multi-omics data (genomics, transcriptomics, proteomics, lipidomics)

  • Host-pathogen interaction studies

  • Structural biology

  • In vivo infection models

What are the most significant knowledge gaps regarding Y. pseudotuberculosis O:1b lgt that require further investigation?

Despite advances in understanding Y. pseudotuberculosis pathogenesis, several critical knowledge gaps remain regarding lgt:

  • The specific lipoproteins processed by lgt that contribute to virulence in O:1b strains

  • The impact of O:1b serotype-specific features on lgt function compared to other serotypes

  • The role of lgt in the evolutionary relationship between Y. pseudotuberculosis O:1b and Y. pestis

  • The potential of lgt as a therapeutic target, given its importance in bacterial physiology

The O:1b serotype is particularly significant as it represents the lineage from which Y. pestis evolved . Understanding lgt function in this context could provide insights into the evolutionary processes that led to the emergence of plague and inform broader questions about bacterial adaptation and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.