Recombinant Yersinia pseudotuberculosis serotype O:1b Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is synthesized using T7 promoter-driven systems in E. coli (e.g., BL21(DE3) strains) . Key steps include:

  • Induction: Optimized IPTG concentrations (0.1–0.4 mM) balance protein yield and host viability .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag yields >90% purity (SDS-PAGE verified) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) for stability .

Production challenges include mRNA toxicity and ribosomal competition, mitigated by CRISPR-based ribosomal binding site optimization .

Virulence and Stress Response Studies

MdtJ exports spermidine, a polyamine linked to:

  • Oxidative stress resistance .

  • Biofilm formation in pathogenic Yersinia species .

  • Interaction with host immune cells (e.g., macrophages) .

Comparative Analysis with Yersinia Effectors

While MdtJ focuses on polyamine transport, other Yersinia proteins like YopJ and YopM directly suppress phagocyte activity :

  • YopJ: Acetylates MAPK pathways, inhibiting pro-inflammatory cytokine release (e.g., COX-2/PGE2) .

  • YopM: Promotes apoptosis in liver macrophages to facilitate bacterial dissemination .

MdtJ’s role in spermidine efflux may indirectly support virulence by mitigating intracellular toxicity during infection .

Evolutionary and Diagnostic Significance

  • Phylogenetic Context: Y. pestis evolved from Y. pseudotuberculosis O:1b, retaining conserved O-antigen gene clusters .

  • PCR Differentiation: Serotype-specific primers distinguish O:1b strains from other Yersinia species .

Technical Considerations for Use

  • Reconstitution: Sterile deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Avoidance of Repeated Freeze-Thaw: Prevents aggregation and activity loss .

Future Research Directions

  • Mechanistic Studies: Elucidate spermidine export kinetics and MdtJ’s interaction with host membranes.

  • Vaccine Development: Explore MdtJ as a candidate antigen in engineered outer membrane vesicles (OMVs) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate your requirement, and we will prioritize its development.
Synonyms
mdtJ; YpsIP31758_2020; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein in Yersinia pseudotuberculosis and what is its primary function?

MdtJ is a membrane protein that forms part of the MdtJI complex involved in spermidine excretion. Similar to its E. coli counterpart, the Y. pseudotuberculosis MdtJ protein belongs to the small multidrug resistance (SMR) family of drug exporters. Its primary function is to catalyze the excretion of spermidine, a polyamine that can become toxic when overaccumulated in bacterial cells. The protein functions as part of a complex with MdtI, as neither protein alone is sufficient for spermidine export function .

How does the MdtJI complex in Y. pseudotuberculosis contribute to bacterial survival?

The MdtJI complex in Y. pseudotuberculosis likely plays a crucial role in polyamine homeostasis by preventing toxic accumulation of spermidine within the bacterial cell. Based on research from E. coli models, when spermidine levels increase, the expression of mdtJI genes is upregulated, enhancing spermidine excretion to maintain appropriate intracellular concentrations. This mechanism helps Y. pseudotuberculosis survive in environments with varying polyamine concentrations and may contribute to its pathogenicity by supporting bacterial survival within host tissues .

What is the genetic organization of the mdtJI operon in Y. pseudotuberculosis?

In Y. pseudotuberculosis, the mdtJI genes are organized in an operon structure similar to that observed in other Enterobacteriaceae. The operon contains two genes: mdtJ and mdtI, which are necessary for the formation of a functional spermidine export complex. Based on research in E. coli, both genes are typically co-expressed, and the mRNA levels increase in response to elevated spermidine concentrations. In Y. pseudotuberculosis, this genetic organization likely facilitates coordinated expression of both components of the export complex in response to environmental stimuli .

What are the recommended methods for cloning and expressing recombinant MdtJ from Y. pseudotuberculosis serotype O:1b?

For cloning and expressing recombinant MdtJ from Y. pseudotuberculosis serotype O:1b, researchers should consider the following methodological approach:

  • Gene Identification and Primer Design: First, identify the mdtJ gene sequence from Y. pseudotuberculosis serotype O:1b genome. Design primers with appropriate restriction sites for the selected expression vector.

  • Expression Vector Selection: Use vectors like pUC or pMW series (as demonstrated with E. coli MdtJI) that have been successful for membrane protein expression .

  • Co-expression Strategy: Since functional studies indicate that both MdtJ and MdtI are necessary for spermidine export activity, consider co-expression strategies similar to those used for E. coli MdtJI complex where both genes were cloned into the same vector .

  • Expression System: Use an expression system lacking endogenous spermidine export capabilities to clearly differentiate the activity of the recombinant protein.

  • Protein Purification: Employ affinity chromatography techniques adapted for membrane proteins, potentially using a His-tag or other fusion tags to facilitate purification.

How can researchers effectively measure spermidine export activity mediated by recombinant MdtJ in laboratory conditions?

Measuring spermidine export activity mediated by recombinant MdtJ in Y. pseudotuberculosis requires specialized techniques:

  • Cell Toxicity Assays: Create a system where spermidine accumulation causes toxicity, such as using a strain deficient in spermidine acetyltransferase (which metabolizes spermidine). Then measure how expression of MdtJI affects cell survival when exposed to high spermidine concentrations .

  • Intracellular Spermidine Measurement: Quantify spermidine content in cells cultured with and without exogenous spermidine (e.g., 2 mM concentration) to determine changes in intracellular levels upon MdtJI expression .

  • Direct Measurement of Spermidine Excretion: Measure spermidine concentrations in the culture medium over time to quantify the rate of export from cells expressing the MdtJI complex versus control cells .

  • Gene Expression Analysis: Employ RT-qPCR to measure changes in mdtJI mRNA levels in response to varying spermidine concentrations, providing insights into the regulation of the export system .

  • Radioactive Labeling: For more precise measurements, use radioactively labeled spermidine to track its movement across the cell membrane in cells expressing recombinant MdtJ.

What is the relationship between MdtJ expression and multidrug resistance in Y. pseudotuberculosis?

Although Y. pseudotuberculosis is generally susceptible to antibiotics active against Gram-negative bacteria, multidrug resistant (MDR) strains have been identified from environmental samples in Russia and clinical samples in France . While the specific role of MdtJ in this resistance has not been directly established, its membership in the small multidrug resistance (SMR) family of transporters suggests potential involvement in antimicrobial resistance mechanisms.

The MdtJI complex may contribute to resistance through:

  • Direct Antibiotic Export: Similar to other SMR proteins, MdtJ might have capacity to export certain antibiotics, though its primary substrate appears to be spermidine .

  • Indirect Resistance Mechanisms: By maintaining polyamine homeostasis, MdtJ may indirectly support the function of other resistance mechanisms or enhance bacterial stress responses.

  • Plasmid Association: MDR in Y. pseudotuberculosis has been linked to IncN and IncHI2 plasmids carrying multiple resistance genes . If mdtJ is encoded on these plasmids, its increased expression could contribute to the MDR phenotype.

Further investigation is needed to determine whether MdtJ overexpression correlates with increased minimum inhibitory concentrations (MICs) for specific antibiotics in Y. pseudotuberculosis.

How does spermidine export via MdtJ potentially influence the efficacy of antimicrobial agents against Y. pseudotuberculosis?

Spermidine export through the MdtJ/MdtI complex may influence antimicrobial efficacy through several mechanisms:

  • Membrane Potential Modulation: Polyamine transport affects membrane potential, which can influence the uptake of antimicrobial agents that require specific electrical gradients across the membrane for entry.

  • Biofilm Formation Support: Polyamines like spermidine play roles in biofilm formation, which can enhance bacterial resistance to antimicrobials. MdtJ-mediated regulation of spermidine levels may therefore indirectly affect biofilm-associated resistance.

  • Stress Response Regulation: Maintaining appropriate polyamine levels via MdtJ contributes to stress response regulation, potentially enhancing bacterial survival during antimicrobial exposure.

  • Interaction with Efflux Systems: The activity of MdtJ might influence or complement other efflux systems implicated in antimicrobial resistance in Y. pseudotuberculosis.

Research investigating correlations between MdtJ activity and antimicrobial susceptibility patterns would help elucidate these relationships more clearly.

How does the structure and function of MdtJ in Y. pseudotuberculosis compare to its homologs in other bacterial species?

The MdtJ protein in Y. pseudotuberculosis shares structural and functional similarities with its homologs in other Enterobacteriaceae, particularly E. coli. Based on comparative analysis:

FeatureY. pseudotuberculosis MdtJE. coli MdtJOther Enterobacteriaceae
Protein FamilySmall Multidrug Resistance (SMR)SMRSMR
Functional UnitComplex with MdtIComplex with MdtIGenerally requires partner protein
Primary SubstrateSpermidine (presumed)SpermidineVaries by species
ActivationUpregulated by spermidine (presumed)Upregulated by spermidineGenerally regulated by substrate
Genetic OrganizationOperonic with mdtIOperonic with mdtITypically operonic arrangement

Key differences may exist in:

  • Substrate Specificity: While the primary substrate appears to be spermidine, Y. pseudotuberculosis MdtJ might have evolved differences in substrate range or affinity compared to E. coli.

  • Regulatory Mechanisms: The regulation of mdtJ expression may differ between species, reflecting their adaptation to different ecological niches.

  • Contribution to Virulence: Given Y. pseudotuberculosis' pathogenic nature, its MdtJ might play additional roles in virulence not present in non-pathogenic bacteria .

What insights can be gained by studying mdtJ gene conservation across Yersinia species?

Studying mdtJ gene conservation across Yersinia species can provide valuable insights into:

  • Evolutionary Adaptation: Variations in mdtJ sequences between Yersinia species may reflect adaptations to different hosts or environmental niches. For instance, highly pathogenic species like Y. pestis might show different conservation patterns compared to less virulent species.

  • Functional Importance: High conservation of mdtJ across Yersinia species would suggest fundamental importance to bacterial survival, while variable regions might indicate species-specific functions.

  • Pathogenicity Correlation: Comparing mdtJ between pathogenic and non-pathogenic Yersinia can help determine if particular variants correlate with virulence.

  • Horizontal Gene Transfer: Analysis of flanking regions and GC content can reveal whether mdtJ has been subject to horizontal gene transfer events, particularly in light of the plasmid-mediated resistance observed in some Y. pseudotuberculosis strains .

  • Target Validation: Conservation analysis helps validate mdtJ as a potential broad-spectrum therapeutic target against multiple Yersinia species.

How can structural modifications to recombinant MdtJ be utilized to study substrate specificity and transport mechanisms?

Advanced structural modifications of recombinant MdtJ can provide detailed insights into its function:

  • Site-Directed Mutagenesis: Targeted mutations of conserved residues can identify amino acids essential for spermidine recognition and transport. Focus on:

    • Transmembrane domains likely involved in forming the transport channel

    • Residues potentially involved in substrate binding

    • Regions mediating interaction with MdtI

  • Domain Swapping: Exchanging domains between MdtJ proteins from different species can help identify regions responsible for substrate specificity differences.

  • Fluorescent Protein Fusions: Creating functional fluorescent protein fusions allows visualization of MdtJ localization and trafficking in living cells.

  • Cysteine Scanning Mutagenesis: Systematic replacement of residues with cysteine, followed by accessibility studies, can map the topology of the transport pathway.

  • Chimeric Proteins: Creating chimeras between MdtJ and other SMR family transporters can reveal determinants of substrate specificity.

These approaches should be evaluated in the context of functional assays measuring spermidine export activity, as described in earlier sections .

What role might MdtJ play in the virulence mechanisms of Y. pseudotuberculosis during host infection?

The potential role of MdtJ in Y. pseudotuberculosis virulence during host infection encompasses several hypotheses:

  • Polyamine Homeostasis in Host Environments: During infection, Y. pseudotuberculosis encounters varying polyamine concentrations in different host tissues. MdtJ may help maintain optimal intracellular polyamine levels, supporting bacterial adaptation to these changing environments.

  • Resistance to Host Defense Mechanisms: Polyamines can protect bacteria against oxidative stress, which is a common host defense. MdtJ-mediated regulation of spermidine levels may enhance survival against host immune responses.

  • Interaction with Virulence Systems: Y. pseudotuberculosis pathogenicity depends largely on the 70 kb plasmid encoding the Yop virulon, which subverts host immune responses . MdtJ may interact with or support these virulence systems through polyamine regulation.

  • Biofilm Formation in Host: If MdtJ influences biofilm formation through polyamine regulation, this could enhance persistence within the host.

  • Adaptation to Antimicrobial Environments: MdtJ may contribute to survival in the presence of host-produced antimicrobial compounds or administered antibiotics, particularly relevant given the emergence of MDR Y. pseudotuberculosis strains .

Experimental approaches to investigate these hypotheses could include creating mdtJ knockout mutants and evaluating their virulence in appropriate infection models.

How might combining recombinant MdtJ with immunologically active Yersinia proteins affect vaccine development strategies?

Incorporating MdtJ into vaccine development strategies for Yersinia infections presents an innovative approach:

  • Bivalent Fusion Protein Approach: Following the model of the successful rVE bivalent fusion protein (combining immunologically active regions of Y. pestis LcrV and YopE) , MdtJ epitopes could be incorporated into fusion constructs. Such constructs might generate both humoral and cell-mediated immune responses against multiple bacterial targets simultaneously.

  • Balanced Immune Response: The rVE fusion approach demonstrated the ability to induce balanced IgG1:IgG2a/IgG2b isotype ratios (1:1) and upregulation of both Th1 (TNF-α, IFN-γ, IL-2, IL-12) and Th2 (IL-4) cytokines . A similar approach with MdtJ could potentially generate comprehensive immune protection.

  • Structure-Based Design: Using I-TASSER implemented composite modeling approaches similar to those used for rVE , researchers could:

    • Identify immunologically active regions of MdtJ

    • Design fusion constructs maintaining epitope accessibility

    • Optimize constructs through energy minimization

  • Cross-Species Protection: Given the conservation of MdtJ across pathogenic Yersinia, inclusion in vaccine formulations might confer protection against multiple species, similar to how rVE provided protection against Y. enterocolitica despite being derived from Y. pestis components .

  • Memory Response Considerations: Research shows that comprehensive protection requires both CD4+ and CD8+ T cell responses . Vaccine designs incorporating MdtJ should evaluate both immediate and memory immune responses (120+ days post-immunization) to ensure long-term protection.

Immune ParameterOptimal Vaccine ProfileEvaluation Method
T-cell ProliferationBoth CD4+ and CD8+ subsetsFlow cytometry
Antibody ResponseBalanced IgG1:IgG2a/IgG2bELISA
Cytokine ProfileBoth Th1 and Th2Cytokine array
Memory ResponseProtection at 120+ daysChallenge studies

What are the major challenges in purifying functional recombinant MdtJ and how can they be addressed?

Purification of functional recombinant MdtJ presents several challenges due to its nature as a membrane protein:

  • Protein Aggregation: Membrane proteins often aggregate during overexpression and purification.
    Solution: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for solubilization, and consider expression at lower temperatures (16-18°C) to reduce aggregation.

  • Co-purification Requirements: Since MdtJ functions as a complex with MdtI , isolated MdtJ may lack functionality.
    Solution: Co-express and co-purify MdtJ with MdtI, possibly using dual-affinity tags to ensure stoichiometric complex formation.

  • Expression System Selection: Standard expression systems may be unsuitable for toxic membrane proteins.
    Solution: Use tightly controlled expression systems with inducible promoters, or consider cell-free expression systems specifically designed for membrane proteins.

  • Maintaining Native Conformation: Detergent solubilization may disrupt protein structure.
    Solution: Consider nanodiscs, amphipols, or styrene-maleic acid lipid particles (SMALPs) to maintain a lipid environment around the protein complex.

  • Functional Verification: Confirming that purified MdtJ retains transport activity is challenging.
    Solution: Develop liposome reconstitution assays to measure spermidine transport activity in a controlled environment.

How can researchers effectively analyze the interaction between MdtJ and MdtI in Y. pseudotuberculosis?

To analyze the MdtJ-MdtI interaction in Y. pseudotuberculosis, researchers can employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against either MdtJ or MdtI to pull down the protein complex, followed by Western blotting to detect the partner protein.

  • Bacterial Two-Hybrid System: Adapted for membrane proteins, this approach can verify interactions in a cellular context and potentially identify critical interacting domains.

  • Förster Resonance Energy Transfer (FRET): By tagging MdtJ and MdtI with appropriate fluorophores, researchers can measure energy transfer as an indication of protein proximity and interaction.

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify specific residues involved in the interaction between MdtJ and MdtI.

  • Mutational Analysis: Systematic mutagenesis of both proteins can identify residues critical for complex formation by assessing the impact on spermidine export activity.

  • Co-expression Studies: Testing whether co-expression is necessary for stability or membrane localization can provide insights into the nature of the complex formation.

  • Structural Studies: Techniques like cryo-electron microscopy may reveal the structural basis of the MdtJ-MdtI interaction, though this represents a significant technical challenge for small membrane protein complexes.

What emerging technologies might enhance our understanding of MdtJ's role in bacterial physiology?

Several cutting-edge technologies show promise for advancing MdtJ research:

  • CRISPR-Cas9 Genome Editing: Precise modification of the mdtJ gene in Y. pseudotuberculosis to create knockout mutants, point mutations, or regulated expression systems without plasmid introduction.

  • Single-Cell Analysis: Technologies such as single-cell RNA-seq can reveal heterogeneity in mdtJ expression within bacterial populations under different conditions.

  • Native Mass Spectrometry: Advances in this technique now allow analysis of intact membrane protein complexes, potentially revealing the stoichiometry and stability of the MdtJ-MdtI complex.

  • In-Cell NMR: This technique could provide structural information about MdtJ in its native environment without purification.

  • Microfluidics-Based Assays: High-throughput systems for measuring spermidine export in single cells or small populations under precisely controlled conditions.

  • Molecular Dynamics Simulations: Computational approaches to model spermidine transport through the MdtJI complex, potentially identifying transient states not captured by static structural methods.

  • Synthetic Biology Approaches: Creating minimal systems with defined components to understand the essential elements required for MdtJ function and regulation.

How might MdtJ research contribute to understanding broader mechanisms of antibiotic resistance in the Enterobacteriaceae family?

MdtJ research has significant implications for understanding antibiotic resistance mechanisms across Enterobacteriaceae:

  • Membrane Transporter Networks: Understanding how MdtJ operates within the broader network of membrane transporters may reveal synergistic relationships between different efflux systems contributing to multidrug resistance.

  • Plasmid-Mediated Resistance: Given that multidrug resistance in Y. pseudotuberculosis has been linked to IncN and IncHI2 plasmids , investigating whether mdtJ is encoded on these plasmids could reveal new aspects of transmissible resistance.

  • Polyamine Metabolism and Resistance: Clarifying links between polyamine homeostasis and antibiotic resistance may uncover novel resistance mechanisms shared across Enterobacteriaceae.

  • Evolutionary Adaptation: Comparing MdtJ sequences and function across antibiotic-resistant and susceptible strains may reveal evolutionary adaptations that contribute to resistance phenotypes.

  • Novel Therapeutic Approaches: Identifying compounds that inhibit MdtJ function could potentially sensitize bacteria to antibiotics, providing adjuvant therapy options for multidrug-resistant infections.

  • Cross-Resistance Mechanisms: Determining whether MdtJ confers resistance to specific classes of antibiotics could help predict cross-resistance patterns in emerging pathogens.

  • Diagnostic Applications: Knowledge of MdtJ's role in resistance could lead to the development of molecular diagnostic tools for predicting antibiotic susceptibility patterns in clinical isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.