Recombinant Yersinia pseudotuberculosis serotype O:1b Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Yersinia pseudotuberculosis Serotype O:1b Sulfoxide Reductase Heme-Binding Subunit YedZ (yedZ)

Recombinant Yersinia pseudotuberculosis serotype O:1b Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a full-length, engineered protein expressed in Escherichia coli for research applications. This protein (UniProt ID: A7FDQ9) spans residues 1–203 and is fused to an N-terminal hexahistidine (His) tag for purification . YedZ belongs to the YedZ family of transmembrane proteins involved in redox processes and heme binding, playing roles in bacterial oxidative stress response and electron transport .

Functional Roles

  • Redox Activity: Functions as a heme-binding partner in sulfoxide reduction systems, facilitating electron transfer from quinones to periplasmic oxidoreductases (e.g., YedY/MsrP) .

  • Oxidative Stress Response: In E. coli, YedZ (MsrQ) collaborates with YedY (MsrP) to repair methionine sulfoxides in periplasmic proteins, utilizing quinones as electron donors .

  • Hypothesized Role in Yersinia: While direct evidence is limited, YedZ may support bacterial survival under host-induced oxidative stress during infection .

Recombinant Expression

ParameterDetails
Host SystemEscherichia coli
TagN-terminal His tag
Amino Acid Range1–203
UniProt AccessionA7FDQ9
Catalog NumberRFL148YF

Key Studies

  1. Electron Transport Mechanism:

    • In E. coli, YedZ (MsrQ) forms a complex with YedY (MsrP) to reduce methionine sulfoxides, dependent on quinones and heme .

    • Deletion of yedZ abolishes methionine sulfoxide reductase activity, highlighting its essential role in redox homeostasis .

  2. Heme Binding and Oxidoreduction:

    • Conserved histidine residues in TMS domains coordinate heme, enabling transmembrane electron flow .

    • Structural homology to FRE/NOX proteins suggests evolutionary links to eukaryotic redox systems .

  3. Potential Pathogenicity Links:

    • While not directly implicated in Yersinia virulence, YedZ may contribute to bacterial resilience against host immune defenses (e.g., reactive oxygen species) .

    • Y. pseudotuberculosis strains lacking redox regulators (e.g., IscR) show impaired type III secretion system (T3SS) function, indirectly linking redox balance to virulence .

Comparative Analysis with Homologues

FeatureY. pseudotuberculosis YedZE. coli YedZ (B7MW36)
Length203 residues211 residues
Heme-Binding SitesConserved His residues in TMSSimilar histidine motifs
FunctionPutative sulfoxide reductaseMethionine sulfoxide reduction

Research Applications

  • Mechanistic Studies: Probe heme-dependent electron transport and sulfoxide reduction pathways.

  • Antimicrobial Target Exploration: Investigate YedZ’s role in bacterial stress adaptation for drug development.

  • Structural Biology: Utilize recombinant YedZ for crystallization or cryo-EM studies to resolve redox mechanisms .

Limitations and Knowledge Gaps

  • Direct functional data on Y. pseudotuberculosis YedZ remains sparse, with most insights extrapolated from E. coli homologues .

  • The protein’s contribution to Yersinia pathogenesis or interaction with virulence factors (e.g., T3SS) is unconfirmed .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; YpsIP31758_0394; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
msrQ
Target Protein Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQ
Uniprot No.

Target Background

Function
YedZ, the heme-binding subunit of the MsrPQ system, plays a crucial role in repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) in *Yersinia pseudotuberculosis* serotype O:1b. This repair process utilizes respiratory chain electrons. MsrPQ safeguards these proteins from oxidative-stress damage caused by reactive oxygen and chlorine species generated by the host defense mechanisms. Its essential role is evident in the maintenance of envelope integrity under bleach stress, rescuing a wide range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ serves as the electron provider for the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ and what is its functional significance in Yersinia pseudotuberculosis?

YedZ is a membrane-bound heme-binding subunit of sulfoxide reductase in Yersinia pseudotuberculosis. The protein contains a heme prosthetic group essential for its electron transfer function in the bacterial respiratory chain. YedZ belongs to the broader family of proteins involved in bacterial redox processes, which may contribute to the organism's survival under various environmental conditions. Yersinia pseudotuberculosis is closely related to Yersinia pestis, the causative agent of plague, though they differ significantly in pathogenicity despite sharing similar virulence mechanisms . The comparative study of proteins like YedZ across Yersinia species can provide insights into their evolutionary relationships and functional adaptations.

How does the structure of YedZ relate to its biological function?

YedZ contains a characteristic heme-binding domain that coordinates the heme prosthetic group through specific amino acid residues. This structural arrangement facilitates electron transfer during sulfoxide reduction reactions. The protein's membrane localization is facilitated by hydrophobic regions that anchor it within the bacterial membrane. Similar to other membrane-bound redox proteins, the precise positioning of YedZ within the membrane is critical for forming functional complexes with partner proteins in the electron transport chain. Understanding this structure-function relationship is essential when designing expression systems for recombinant production, as modifications may need to preserve the heme-binding capacity and membrane association properties.

What expression systems are most suitable for recombinant YedZ production?

Several expression systems can be employed for recombinant YedZ production, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
E. coli (standard)High yield, ease of useInclusion body formation, improper heme incorporationInitial screening, structural studies after refolding
E. coli with special tagsImproved solubilityTag removal may affect functionPurification optimization studies
E. coli with chaperonesReduced inclusion bodiesLower yield, complex optimizationFunctional studies requiring native conformation
Yersinia-based systemNative post-translational modificationsLower yield, biosafety concernsFunctional studies, vaccine development

Research with membrane proteins like YedZ often encounters expression challenges due to their hydrophobic regions and cofactor requirements. Recombinant enzyme expression in Escherichia coli, while popular for producing bulk protein, is frequently limited by inclusion body formation . For YedZ specifically, ensuring proper heme incorporation presents an additional challenge that may require specialized expression conditions or co-expression with heme biosynthesis components.

How can inclusion body formation be minimized when expressing recombinant YedZ?

Inclusion body formation is a common challenge when expressing membrane proteins like YedZ. Several strategies can be implemented:

  • Optimize growth temperature: Lowering the incubation temperature to 16-25°C can slow protein synthesis and promote proper folding.

  • Adjust inducer concentration: Using lower concentrations of inducers like IPTG (0.1-0.5 mM instead of 1 mM) can reduce expression rate and improve folding.

  • Co-express with molecular chaperones: Systems co-expressing GroEL/GroES, DnaK/DnaJ/GrpE, or specialized membrane protein chaperones can assist proper folding.

  • Use solubility-enhancing fusion partners: Fusion tags like MBP (maltose-binding protein), SUMO, or Trx (thioredoxin) can significantly improve solubility.

  • Supplement growth media with heme or its precursors: For heme-binding proteins like YedZ, adding δ-aminolevulinic acid or hemin to the culture medium can facilitate proper cofactor incorporation.

The literature indicates an absence of coherent strategy for expressing difficult proteins, with researchers using disparate practices to promote solubility . A systematic approach using modern bioinformatics, modeling, and systems-level analysis would likely yield better results for challenging membrane proteins like YedZ.

What purification strategies are most effective for recombinant YedZ?

Purification of membrane proteins like YedZ requires specialized approaches:

Purification StepMethodologyCritical ParametersQuality Control
Membrane extractionDetergent solubilizationDetergent type and concentrationProtein activity retention
IMAC purificationNi-NTA chromatographyImidazole concentration gradientPurity assessment by SDS-PAGE
Size exclusionGel filtrationBuffer compositionOligomeric state verification
Heme analysisUV-visible spectroscopySpectral signatures at 410-420 nmHeme incorporation ratio

When working with membrane proteins containing prosthetic groups, maintaining the native-like environment throughout purification is essential. For YedZ, the purification buffer should contain appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) at concentrations above their critical micelle concentration. Additionally, including reducing agents and stabilizing additives can help preserve protein integrity and heme coordination.

How can proper heme incorporation be verified in recombinant YedZ?

Verification of proper heme incorporation is critical for ensuring functional YedZ:

  • UV-visible spectroscopy: Heme-containing proteins exhibit characteristic absorption peaks at approximately 410-420 nm (Soret band) and 530-560 nm (Q bands). The exact wavelengths and relative intensities depend on the heme oxidation state and coordination environment.

  • Pyridine hemochromogen assay: This method can quantify the heme content by forming pyridine-heme complexes with distinctive spectral properties.

  • Electron paramagnetic resonance (EPR): EPR can provide detailed information about the heme iron oxidation state and its coordination environment.

  • Functional assays: Activity measurements using sulfoxide substrates can indirectly confirm proper heme incorporation by demonstrating electron transfer capability.

  • Mass spectrometry: High-resolution mass spectrometry can confirm the presence of the heme moiety and its covalent attachment, if applicable.

The ratio of heme to protein should be determined to assess incorporation efficiency, with a 1:1 ratio indicating complete incorporation in the case of YedZ, which contains a single heme-binding site.

How should experiments be designed to investigate YedZ's role in Y. pseudotuberculosis pathogenesis?

Investigating YedZ's role in pathogenesis requires a multifaceted approach:

  • Gene knockout studies: Create ΔyedZ mutants in Y. pseudotuberculosis and assess virulence in appropriate infection models. Similar to studies on YopK and YopJ virulence factors , analyzing colonization patterns and bacterial numbers in target organs would be informative.

  • Complementation experiments: Reintroduce wild-type or mutated yedZ to confirm phenotype restoration and identify critical functional residues.

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and ΔyedZ strains under various conditions to identify regulatory networks.

  • Host-pathogen interaction studies: Assess the impact of YedZ on host immune responses, potentially using macrophage infection models or animal studies similar to those used for Y. pestis vaccine development .

  • Environmental stress response: Investigate YedZ's role in bacterial survival under oxidative stress, nutrient limitation, or other conditions relevant to the infection process.

When designing these experiments, control strains should include not only the wild-type bacteria but also strains with mutations in genes encoding functionally related proteins to distinguish specific effects from general disruptions in redox processes.

What approaches are recommended for studying YedZ interactions with other proteins?

Understanding protein-protein interactions involving YedZ requires specialized techniques for membrane proteins:

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can identify potential interaction partners in vivo.

  • Pull-down assays with crosslinking: Chemical crosslinking prior to purification can stabilize transient interactions between YedZ and partner proteins.

  • Co-immunoprecipitation with membrane fractions: Using antibodies against YedZ or potential partners to isolate protein complexes from membrane preparations.

  • Proximity labeling techniques: Methods like BioID or APEX2 can identify proteins in close proximity to YedZ in the native membrane environment.

  • Proteomic analysis of membrane fractions: Comparative proteomics of membrane fractions from wild-type and ΔyedZ strains can reveal composition changes in protein complexes.

Data from these complementary approaches should be compiled in comprehensive interaction maps, similar to data organization tables used in qualitative research , to visualize the YedZ interactome and generate hypotheses about functional relationships.

How can recombinant YedZ be utilized in vaccine development strategies?

YedZ could be explored as a potential vaccine component using these approaches:

  • Antigen delivery systems: Similar to the strategy used with YopE-LcrV fusion proteins , YedZ could be incorporated into recombinant attenuated Yersinia strains as a carrier or fusion partner for protective antigens.

  • Epitope mapping: Identify immunogenic regions of YedZ that could elicit protective immune responses against Y. pseudotuberculosis or potentially cross-reactive responses against Y. pestis.

  • Structure-based vaccine design: Utilizing structural information about YedZ to design stable, soluble fragments that maintain key antigenic properties.

  • Adjuvant co-delivery: Investigate whether YedZ has inherent immunomodulatory properties that could enhance immune responses to co-delivered antigens.

  • Mucosal immunity studies: Assess whether YedZ-based constructs can stimulate protective mucosal immune responses, as seen with other Yersinia antigens .

When evaluating vaccine potential, researchers should analyze both humoral and cellular immune responses through comprehensive immunological profiling, including antibody titers, T-cell responses, and protection in appropriate challenge models.

What are the most effective approaches for analyzing YedZ structure-function relationships?

Structure-function analysis of YedZ should combine computational and experimental approaches:

  • Homology modeling and molecular dynamics: Generate structural models based on related proteins and simulate behavior in membrane environments.

  • Site-directed mutagenesis: Systematically alter residues involved in heme binding, membrane anchoring, or predicted interaction interfaces.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify regions of differential solvent accessibility that may indicate interaction surfaces or conformational changes.

  • Electron microscopy: For larger complexes involving YedZ, cryo-EM can provide structural insights at near-atomic resolution.

  • Activity assays with structure-informed variants: Correlate structural features with functional readouts using enzymatic assays for sulfoxide reduction.

Results from these studies should be organized using concept-evidence tables that systematically link structural elements to functional properties, facilitating comprehensive understanding of structure-function relationships.

How can researchers address protein instability issues with recombinant YedZ?

Protein instability is a common challenge when working with membrane proteins like YedZ:

ChallengePotential CausesSolutionsMonitoring Methods
Rapid degradationProteolytic susceptibilityProtease inhibitors, fusion to stabilizing tagsSDS-PAGE time course
Loss of hemeOxidative damage, improper buffer conditionsReducing agents, anaerobic handlingAbsorption spectroscopy
AggregationHydrophobic interactions, improper detergentScreen detergent types and concentrationsDynamic light scattering
Conformational heterogeneityFlexible domains, multiple statesStabilizing ligands, nanobodiesThermal shift assays

For heme-containing membrane proteins specifically, maintaining the redox environment is critical. Using buffers with mild reducing agents (e.g., 1-5 mM DTT or 2-10 mM β-mercaptoethanol) and handling samples under nitrogen atmosphere when possible can significantly improve stability. Additionally, storage conditions should be carefully optimized, potentially including cryoprotectants for frozen storage.

What strategies help overcome expression barriers for difficult-to-express proteins like YedZ?

For proteins that prove difficult to express in conventional systems:

  • Codon optimization: Adjust codon usage to match the expression host, especially for rare codons encoding key structural elements.

  • Expression strain engineering: Select or design expression hosts with enhanced capabilities for membrane protein expression or heme incorporation.

  • Fusion protein design: Create fusion constructs that expose critical epitopes while removing problematic regions that hinder expression.

  • Cell-free expression systems: Utilize cell-free systems that can be supplemented with specialized components for membrane protein folding.

  • High-throughput screening approaches: Implement systematic screening of expression conditions using design of experiments (DoE) methodology.

Research indicates that approaching recombinant expression systematically, with the aid of modern bioinformatics, modeling, and systems-level analysis techniques provides a more structured, holistic approach than the currently prevalent disparate practices .

How should researchers analyze conflicting data regarding YedZ function?

When faced with conflicting experimental results:

  • Systematic comparison: Create a temporally ordered table documenting all conflicting results, experimental conditions, and methodological differences.

  • Reproducibility assessment: Evaluate the reproducibility of each result by examining methodological details and statistical analyses.

  • Condition-dependent effects: Consider whether differences in experimental conditions (pH, temperature, redox state) might explain divergent results.

  • Strain-specific variations: Assess whether genetic differences between bacterial strains could account for functional variations in YedZ.

  • Meta-analysis approach: Synthesize available data using formal meta-analysis techniques to identify consistent patterns despite variability.

Researchers should consider creating typologically ordered tables that organize findings by experimental approach, allowing systematic comparison across methodologies to identify whether conflicts are technique-specific or represent genuine biological complexity.

What statistical approaches are most appropriate for analyzing YedZ activity data?

For rigorous analysis of enzymatic activity data:

  • Appropriate replication: Minimum of three biological replicates and three technical replicates per condition.

  • Normalization strategies: Account for variations in protein concentration, heme incorporation, and background activity.

  • Enzyme kinetics modeling: Apply Michaelis-Menten or more complex models as appropriate for the reaction mechanism.

  • Comparative statistics: Use ANOVA with appropriate post-hoc tests for comparing multiple conditions or variants.

  • Correlation analysis: Examine relationships between structural parameters (e.g., heme incorporation efficiency) and functional outcomes.

Data visualization should include both raw data points and statistical summaries, with error bars representing standard deviation or standard error as appropriate. Researchers should explicitly state all statistical methods, transformations, and outlier criteria in their methodological descriptions.

What are the most promising avenues for advancing YedZ research?

Future research directions that could significantly advance understanding of YedZ include:

  • Comprehensive interactome mapping: Identify all protein partners of YedZ in various growth conditions and infection states.

  • Structural biology approaches: Obtain high-resolution structures of YedZ alone and in complexes with partner proteins.

  • In vivo imaging: Develop methods to visualize YedZ localization and dynamics during infection processes.

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data to place YedZ in broader cellular networks.

  • Comparative analysis across Yersinia species: Systematic comparison of YedZ function in pathogenic and non-pathogenic Yersinia species.

How can systems biology approaches enhance understanding of YedZ function?

Systems biology offers powerful frameworks for understanding proteins like YedZ:

  • Network analysis: Position YedZ within redox and metabolic networks using genome-scale models.

  • Flux balance analysis: Predict metabolic consequences of YedZ perturbation using computational modeling.

  • Multi-scale modeling: Integrate molecular dynamics simulations with cellular-level models.

  • Machine learning applications: Apply machine learning to predict conditions where YedZ function is critical.

  • Synthetic biology approaches: Design minimal systems to test hypotheses about YedZ function in controlled contexts.

Research in difficult-to-express enzymes like YedZ would benefit from systems-level analysis techniques to provide a structured, holistic approach . Creating co-occurrence tables that document the presence and functional relationships of YedZ-like proteins across diverse bacterial species could reveal evolutionary patterns and functional significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.