Recombinant Yersinia pseudotuberculosis serotype O:1b Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
uspB; YpsIP31758_4034; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary relationship between Y. pseudotuberculosis serotype O:1b and Y. pestis?

Y. pseudotuberculosis serotype O:1b is the direct evolutionary precursor of Yersinia pestis, the causative agent of plague. Molecular analysis of O-antigen gene clusters reveals that Y. pestis is most closely related to and has evolved from Y. pseudotuberculosis serotype O:1b specifically. Comparative genomic studies show that at the nucleotide sequence level, the O-antigen gene clusters (approximately 20.5 kb each) are 98.9% identical between these two species. The critical evolutionary difference lies in the silencing of the O-antigen biosynthetic pathway in Y. pestis, where five of the 17 biosynthetic genes identified from the O:1b gene cluster were inactivated through insertions or deletions . Four of these genes were silenced by insertions or deletions of a single nucleotide, while one was inactivated by a deletion of 62 nucleotides, demonstrating how relatively minor genetic changes led to the emergence of one of history's most virulent pathogens.

How does Universal stress protein B (uspB) function in Y. pseudotuberculosis serotype O:1b?

Universal stress protein B functions as a critical stress response element in Y. pseudotuberculosis serotype O:1b, responding to various environmental stressors including temperature shifts, oxidative stress, nutrient limitation, and host immune responses. The protein operates through ATP-dependent signaling pathways that regulate transcriptional and post-translational modifications of various stress-responsive genes. Unlike conventional stress response proteins that target specific stressors, uspB demonstrates a broader response spectrum, activating when the bacterial cell encounters various adverse conditions, particularly those relevant to host infection processes.

In Y. pseudotuberculosis serotype O:1b, uspB expression is upregulated during the transition from environmental temperatures (26°C) to mammalian body temperature (37°C), suggesting its involvement in adaptation to the host environment. This temperature-dependent regulation parallels observations seen with virulence factors like the F1 antigen, which is expressed at 37°C but not at 26°C in recombinant Y. pseudotuberculosis strains . Methodologically, researchers can measure uspB expression using quantitative RT-PCR at different temperatures and stress conditions to characterize its role in stress adaptation.

What are the recommended approaches for creating recombinant Y. pseudotuberculosis strains expressing uspB?

The creation of recombinant Y. pseudotuberculosis strains expressing modified Universal stress protein B requires careful genetic engineering approaches. The recommended methodology involves a chromosomal insertion strategy rather than plasmid-based expression to ensure stability of the genetic construct. Based on successful approaches with other Y. pseudotuberculosis recombinant systems, researchers should consider a three-step process: (1) PCR amplification of the uspB gene with appropriate promoter sequences, (2) construction of an integration vector containing the amplified fragment, and (3) homologous recombination-mediated chromosomal insertion.

For optimal results, integration should target neutral sites in the Y. pseudotuberculosis genome, such as the lacZ locus, which has been successfully used for insertion of other genes like the caf1 operon without affecting bacterial growth characteristics . Additionally, researchers should incorporate verification steps including PCR confirmation of integration, whole-genome sequencing to confirm the absence of off-target effects, and expression analysis using Western blotting with anti-uspB antibodies at different temperatures (26°C and 37°C). Growth rate comparison between wild-type and recombinant strains under standard conditions (BHI broth at 26°C with shaking at 180 rpm) is essential to verify that genetic modifications do not impair bacterial fitness.

How should researchers design experiments to evaluate the immunogenicity of recombinant Y. pseudotuberculosis expressing modified uspB?

Evaluating immunogenicity of recombinant Y. pseudotuberculosis expressing modified uspB requires a comprehensive approach that addresses both humoral and cell-mediated immune responses. A methodologically sound experimental design should include multiple arms: (1) recombinant strain expressing the modified uspB, (2) wild-type strain as control, (3) purified uspB protein for comparison, and (4) appropriate adjuvant controls. Implementation should follow a prime-boost immunization schedule with sampling at multiple timepoints to track the development of immune responses.

For humoral immunity assessment, researchers should collect serum samples at days 0, 14, 28, and 42 post-immunization for ELISA detection of anti-uspB and other Y. pseudotuberculosis antigen-specific antibodies. Antibody isotyping (IgG, IgM, IgA) provides crucial information about the type of immune response generated. For cell-mediated immunity, splenocytes and lymph node cells should be isolated from immunized animals and stimulated ex vivo with purified uspB protein. Flow cytometric analysis of CD4+ and CD8+ T-cell activation markers (CD69, CD25) and intracellular cytokine staining (IFN-γ, IL-2, TNF-α) will reveal T-cell response profiles. Additionally, ELISpot assays for IFN-γ and IL-4 provide quantitative measures of Th1 versus Th2 responses. Similar methodologies have been successfully applied in studies of other Y. pseudotuberculosis recombinant vaccines, where specific T-cell responses to antigens such as F1 were effectively primed .

What techniques are most effective for measuring uspB expression under different stress conditions?

Measuring Universal stress protein B expression under various stress conditions requires a multi-technique approach that captures both transcriptional and translational regulation. Quantitative RT-PCR remains the gold standard for transcriptional analysis, requiring careful primer design targeting the uspB gene with appropriate reference genes (such as 16S rRNA and rpoD) for normalization. The ΔΔCt method provides relative quantification of uspB expression changes under different stress conditions compared to standard growth conditions.

For translational analysis, Western blotting using anti-uspB antibodies offers direct visualization of protein levels, while mass spectrometry-based proteomics enables broader analysis of stress response networks. Reporter gene fusions (uspB promoter fused to luxCDABE or GFP) allow for real-time monitoring of uspB expression in living bacteria using microplate readers or flow cytometry. When implementing these techniques, researchers should subject Y. pseudotuberculosis cultures to relevant stress conditions including temperature shifts (26°C to 37°C), oxidative stress (H₂O₂ exposure), nutrient limitation, and antimicrobial peptides. Statistical analysis should employ two-way ANOVA to evaluate the effects of both stressor type and exposure duration on uspB expression, with post-hoc tests for pairwise comparisons. This methodological framework enables comprehensive characterization of uspB's role in stress response mechanisms.

How does recombinant Y. pseudotuberculosis serotype O:1b compare to other plague vaccine platforms?

Recombinant Y. pseudotuberculosis serotype O:1b represents a distinctive plague vaccine platform with several methodological advantages compared to traditional approaches. Unlike the conventional F1V subunit vaccines that provide limited antigen presentation, Y. pseudotuberculosis-based vaccines can be engineered to express multiple plague antigens simultaneously while maintaining their natural conformation. Studies demonstrate that outer membrane vesicles (OMVs) derived from recombinant Y. pseudotuberculosis strains expressing Y. pestis antigens provide superior protection compared to the F1V subunit vaccine .

The primary advantage lies in the route of administration and subsequent immune response. As an enteric bacterium, Y. pseudotuberculosis is naturally suited for oral vaccination, which stimulates both mucosal and systemic immunity. Research has shown that oral immunization with a single dose of recombinant Y. pseudotuberculosis strain χ10068 provided 70% protection against subcutaneous challenge with ~2.6 × 10⁵ LD₅₀ of Y. pestis and 90% protection against intranasal challenge with ~500 LD₅₀ . This compares favorably to current subunit vaccines that typically require multiple doses with adjuvants to achieve similar protection levels. Additionally, the attenuated Y. pseudotuberculosis platform offers inherent adjuvant properties through its pathogen-associated molecular patterns, eliminating the need for external adjuvants. When considering manufacturing processes, the Y. pseudotuberculosis platform requires standard bacterial fermentation technology rather than the more complex protein purification processes needed for subunit vaccines.

What role might uspB modifications play in enhancing vaccine efficacy?

Strategic modifications to Universal stress protein B in recombinant Y. pseudotuberculosis could significantly enhance vaccine efficacy through multiple mechanisms. Enhanced stress tolerance conferred by optimized uspB variants could improve bacterial survival during vaccine manufacturing, storage, and post-administration survival in the harsh gastrointestinal environment. This would potentially increase the effective dose delivered to immune induction sites. Methodologically, researchers should integrate codon-optimized uspB variants with enhanced expression under stress conditions, particularly at the mammalian body temperature of 37°C.

Furthermore, uspB modifications can be designed to boost immunogenicity by introducing immunodominant epitopes from Y. pestis antigens directly into non-essential regions of the uspB protein. This chimeric approach allows presentation of plague antigens in the context of a highly expressed stress protein. To evaluate such modifications, researchers should employ epitope mapping of uspB using overlapping peptide libraries to identify permissive insertion sites, followed by in silico analysis to predict the structural impact of modifications. The immunological outcomes can be measured through techniques such as T-cell proliferation assays, cytokine profiling, and antibody titer determination following immunization with the modified strains. Previous studies with recombinant Y. pseudotuberculosis have demonstrated the effectiveness of antigen-specific T-cell responses in providing protection against Y. pestis challenge , suggesting that uspB-mediated enhancement of these responses could further improve vaccine efficacy.

What are the optimal immunization protocols for recombinant Y. pseudotuberculosis vaccines expressing uspB modifications?

Optimal immunization protocols for recombinant Y. pseudotuberculosis vaccines expressing uspB modifications should address dosage, scheduling, route of administration, and potential combinatorial approaches. Based on previous successful studies with similar recombinant Y. pseudotuberculosis strains, a methodologically sound approach begins with dose determination through escalating dose studies (10⁴ to 10⁹ CFU) to identify the minimal effective dose that balances safety and immunogenicity.

For oral immunization, which capitalizes on Y. pseudotuberculosis' natural route of infection, protocols should include pre-treatment with sodium bicarbonate buffer to neutralize stomach acid and protect the bacterial vaccine. The optimal schedule appears to be either a single high-dose immunization (as demonstrated with strain χ10068 ) or a prime-boost regimen with 4 weeks between doses for enhanced immune response longevity. Alternative routes including intranasal and sublingual administration should be comparatively evaluated for their ability to induce mucosal immunity at respiratory surfaces - the primary site of plague infection. When implementing these protocols, researchers should monitor both short-term adverse events (within 14 days) and long-term protection through challenge studies at multiple time points (30, 90, and 180 days post-immunization). Protection metrics should include survival rates, bacterial burden in tissues, time to death in non-survivors, and correlation with immune parameters (antibody titers and T-cell responses) to establish immunological correlates of protection.

How do stress response mechanisms differ between Y. pseudotuberculosis serotype O:1b and Y. pestis?

Stress response mechanisms between Y. pseudotuberculosis serotype O:1b and Y. pestis reflect their adaptations to distinct ecological niches and transmission cycles. Y. pseudotuberculosis, as an enteric pathogen, possesses robust stress response systems for surviving the gastrointestinal environment, including acid resistance mechanisms and temperature-responsive gene regulation that functions effectively across broader temperature ranges. In contrast, Y. pestis has evolved specialized stress responses for arthropod-mammalian transmission cycles, with reduced functionality in enteric stress pathways but enhanced resistance to insect-derived antimicrobial peptides.

The methodological approach to studying these differences involves comparative transcriptomics and proteomics under standardized stress conditions. RNA-Seq analysis of both species exposed to identical stressors (oxidative stress, temperature shifts, nutrient limitation) reveals divergent transcriptional responses, with Y. pseudotuberculosis typically showing broader stress response gene activation. This reflects the greater environmental versatility required for its lifestyle. Quantitative proteomic approaches using iTRAQ or TMT labeling further illuminate post-transcriptional regulatory differences. These analyses consistently demonstrate that despite their close genetic relationship (98.9% identity in O-antigen gene clusters ), the functional stress responses have diverged significantly. Y. pestis shows evidence of genome decay in several stress response pathways, with approximately 13% of Y. pseudotuberculosis stress response genes being inactivated or deleted in Y. pestis, while maintaining or enhancing expression of those critical for its vector-borne transmission.

What genomic adaptations in Y. pseudotuberculosis serotype O:1b make it suitable for recombinant vaccine development?

Y. pseudotuberculosis serotype O:1b possesses several genomic features that make it particularly suitable for recombinant vaccine development. Its genome contains multiple stable sites for heterologous gene insertion, including the lacZ locus which has been successfully used for insertion of Y. pestis antigens without affecting bacterial fitness . Methodologically, researchers can identify additional integration sites through whole-genome analysis for regions with low gene density and minimal impact on virulence or metabolism when disrupted.

The O:1b serotype specifically offers advantages due to its lipopolysaccharide (LPS) structure, which provides a balanced immunostimulatory effect without excessive toxicity. This serotype can be further optimized by engineering strains to synthesize the adjuvant form of lipid A (monophosphoryl lipid A [MPLA]), as demonstrated in previous studies . The naturally high production of outer membrane vesicles (OMVs) by Y. pseudotuberculosis provides an additional advantage, as these vesicles can effectively deliver antigens to the immune system. Research has shown that recombinant Y. pseudotuberculosis strains dramatically increase the production of OMVs containing high amounts of heterologous antigens compared to their Y. pestis counterparts .

From a safety perspective, Y. pseudotuberculosis is significantly less virulent than Y. pestis while maintaining sufficient antigenic similarity to induce cross-protective immunity. Genomic analysis reveals that Y. pseudotuberculosis lacks certain key virulence factors of Y. pestis while retaining many immunogenic antigens, making it an ideal balance of safety and efficacy for vaccine development.

How can researchers address potential genetic instability in recombinant Y. pseudotuberculosis expressing modified uspB?

Genetic instability presents a significant challenge in developing recombinant Y. pseudotuberculosis vaccines expressing modified Universal stress protein B. To systematically address this issue, researchers should employ a multi-faceted approach beginning with strategic construct design. Methodologically, codon optimization of the modified uspB gene for Y. pseudotuberculosis enhances expression while reducing the metabolic burden that can drive selective pressure against the insert. Researchers should avoid repetitive sequences and design constructs with GC content similar to the host genome (approximately 47-48% for Y. pseudotuberculosis).

For chromosomal integration, neutral sites such as pseudogenes or non-essential genes should be targeted rather than relying on plasmid-based expression, which is inherently less stable. Integration can be confirmed through whole-genome sequencing to verify the absence of unwanted mutations or rearrangements. Stability testing protocols should include serial passaging of the recombinant strain (minimum 50 passages) under various stress conditions, with intermittent verification of the uspB sequence and expression levels. Flow cytometry with fluorescent antibodies against uspB can rapidly identify population heterogeneity that might indicate emerging instability.

Conditional expression systems using temperature-sensitive promoters can reduce selective pressure during manufacturing while ensuring appropriate expression in vivo. Previous research has demonstrated that recombinant Y. pseudotuberculosis can maintain stable expression of heterologous antigens like the F1 antigen from Y. pestis, which is expressed at 37°C but not at 26°C . This temperature-dependent regulation approach can be adapted for modified uspB expression to enhance genetic stability.

What are the most effective methods for analyzing the structure-function relationship of modified uspB proteins?

Understanding the structure-function relationship of modified Universal stress protein B requires an integrated approach combining computational predictions with experimental validation. X-ray crystallography remains the gold standard for determining high-resolution protein structures, requiring purification of recombinant uspB to >95% homogeneity through affinity chromatography followed by crystallization screening. Cryo-electron microscopy provides an alternative approach for proteins resistant to crystallization, while nuclear magnetic resonance (NMR) spectroscopy can reveal dynamic aspects of uspB function and interaction with binding partners.

Computational approaches should begin with homology modeling based on solved structures of related universal stress proteins, followed by molecular dynamics simulations to predict the impact of modifications on protein stability and function. Site-directed mutagenesis targeting predicted functional domains allows experimental validation of computational predictions. Key residues identified in silico can be systematically mutated, and the resulting variants can be assessed for stress response functions through complementation studies in uspB-knockout strains.

Protein-protein interaction networks can be mapped using techniques such as bacterial two-hybrid screening or pull-down assays coupled with mass spectrometry. This reveals how uspB integrates into broader stress response pathways and how modifications might alter these interactions. Structural information should guide the design of chimeric uspB variants containing Y. pestis epitopes inserted at surface-exposed loops that tolerate modification without disrupting protein folding. Success in similar structural biology approaches with Y. pseudotuberculosis proteins suggests these methodologies are feasible for uspB structure-function analysis.

What experimental designs best address potential contradictory data in uspB function studies?

Addressing contradictory data in Universal stress protein B function studies requires robust experimental designs that systematically control for variables that may influence results. A comprehensive approach should begin with strain standardization - using isogenic Y. pseudotuberculosis strains with identical genetic backgrounds except for the specific uspB modifications under investigation. Researchers must implement precise documentation of growth conditions, as minor variations in media composition, pH, oxygen levels, and growth phase significantly impact stress response gene expression.

A factorial experimental design allows systematic evaluation of interaction effects between variables. For example, a 3×3×2 design could examine three uspB variants under three stress conditions at two temperatures, with appropriate replication. Statistical approaches should include multivariate analysis to identify patterns across datasets and meta-analysis techniques to systematically compare results from different laboratories. When contradictory results persist despite these controls, researchers should consider biological explanations such as strain-specific effects, compensatory mechanisms, or condition-specific protein functions rather than assuming methodological error. Publishing comprehensive methodology sections that include seemingly minor details of experimental procedures is essential for addressing reproducibility issues in uspB function studies.

How does the immune response to recombinant Y. pseudotuberculosis expressing uspB differ from responses to wild-type strains?

Recombinant Y. pseudotuberculosis expressing modified Universal stress protein B generates a distinct immunological profile compared to wild-type strains, with important implications for vaccine development. The primary difference lies in antigen-specific responses, where the modified uspB serves as both an immunogen and a potential adjuvant. Flow cytometric analysis of dendritic cell activation markers (CD80, CD86, MHC II) reveals that recombinant strains typically induce enhanced dendritic cell maturation compared to wild-type strains, likely due to altered pathogen-associated molecular pattern presentation.

T-cell polarization also differs significantly, with recombinant strains engineered for uspB modification typically shifting the response toward a balanced Th1/Th17 profile that is advantageous for protection against Y. pestis. This can be measured through intracellular cytokine staining of CD4+ T cells for signature cytokines (IFN-γ, IL-17, IL-4) following ex vivo restimulation with antigenic preparations. Antibody responses show enhanced recognition of both uspB epitopes and co-expressed Y. pestis antigens when compared to wild-type strains, with higher avidity antibodies that can be measured through chaotropic ELISAs using increasing concentrations of ammonium thiocyanate.

Methodologically, researchers should employ a comprehensive immunophenotyping approach including multiparameter flow cytometry, multiplex cytokine assays, and systems immunology techniques such as CyTOF to fully characterize these differential responses. Previous studies with recombinant Y. pseudotuberculosis have demonstrated that such strains can effectively prime antibody responses and specific T-cell responses to heterologous antigens like the F1 antigen from Y. pestis , suggesting that modified uspB would similarly enhance immune responses against targeted plague antigens.

What methods effectively measure cross-protection between Y. pseudotuberculosis and Y. pestis immune responses?

Measuring cross-protection between Y. pseudotuberculosis and Y. pestis immune responses requires methodological approaches that address both humoral and cellular immunity across multiple antigens. For antibody cross-reactivity assessment, researchers should implement competitive ELISAs where sera from animals immunized with recombinant Y. pseudotuberculosis are tested for binding to plates coated with Y. pestis antigens, with competition from soluble homologous or heterologous antigens. This quantifies the proportion of antibodies recognizing shared versus species-specific epitopes.

Western blot analysis using whole cell lysates provides a comprehensive view of the antigen recognition profile, while epitope mapping with peptide arrays identifies specific cross-reactive epitopes that could serve as targets for vaccine improvement. For cellular immunity, lymphocyte proliferation assays using CFSE-labeled splenocytes stimulated with antigens from both species quantifies cross-reactive T-cell populations, while ELISpot assays for IFN-γ and IL-17 measure functional cross-reactivity of T-cell responses.

The gold standard for cross-protection assessment remains heterologous challenge studies, where animals immunized with recombinant Y. pseudotuberculosis expressing uspB modifications are challenged with virulent Y. pestis through different routes (subcutaneous, intranasal, aerosol). Protection metrics should include survival rates, bacterial burden in tissues, and time to death in non-survivors. Previous research has demonstrated that immunization with recombinant Y. pseudotuberculosis can provide significant protection against Y. pestis challenge, with protection levels of 70-90% depending on the route of challenge . Statistical analysis should employ Kaplan-Meier survival curves with log-rank tests for significance assessment, while correlating protection with specific immune parameters to establish immunological correlates of cross-protection.

How might CRISPR-Cas systems advance the development of recombinant Y. pseudotuberculosis vaccine strains?

CRISPR-Cas genome editing technologies offer transformative approaches for developing next-generation recombinant Y. pseudotuberculosis vaccine strains. The methodological advantage of CRISPR-Cas9 lies in its precision for multiplexed gene modifications with minimal off-target effects. For vaccine development, researchers can implement several strategic applications: (1) precise deletion of virulence factors to create optimally attenuated strains, (2) simultaneous modification of multiple stress response genes including uspB to enhance vaccine strain survival, and (3) targeted integration of heterologous antigens at multiple genomic loci.

Base editing variants of CRISPR systems enable introduction of point mutations without double-strand breaks, allowing fine-tuning of gene expression rather than complete knockouts. This approach can modify uspB promoter regions to optimize expression levels under specific conditions relevant to vaccination. Recent advances in CRISPR delivery systems for Yersinia species have overcome previous transformation efficiency limitations, with optimized protocols achieving transformation efficiencies of 10⁵-10⁶ transformants per μg DNA.

For implementation, researchers should employ a two-plasmid system: one carrying the Cas9 nuclease under an inducible promoter and another containing the guide RNA targeting the desired modification site along with a homology-directed repair template. Screening for successful modifications can be streamlined through CRISPR-based cell marking systems that couple successful editing events with reporter gene expression. Studies with other bacterial vaccine platforms have demonstrated that CRISPR-engineered strains maintain their genetic modifications with greater stability than those created using traditional recombineering approaches, suggesting similar benefits would apply to Y. pseudotuberculosis vaccine development.

What bioinformatic approaches can identify optimal uspB modifications for enhanced vaccine efficacy?

Advanced bioinformatic approaches can systematically identify optimal Universal stress protein B modifications to enhance vaccine efficacy through a multi-step computational pipeline. Researchers should begin with comparative genomic analysis of uspB sequences across Yersinia species and strains to identify conserved domains (essential for function) and variable regions suitable for modification. Structural prediction tools including AlphaFold2 and RoseTTAFold can generate high-confidence 3D models of uspB, highlighting surface-exposed loops suitable for antigen insertion without disrupting protein folding or function.

Immunoinformatic algorithms can then be applied to identify and rank Y. pestis epitopes based on predicted binding to multiple MHC alleles, focusing on epitopes that activate both CD4+ and CD8+ T cells. Tools such as NetMHCpan and IEDB analysis resources provide quantitative binding predictions across diverse HLA types. Molecular dynamics simulations can further assess how candidate epitope insertions affect uspB stability and dynamics, with preference given to modifications that maintain native protein characteristics.

To optimize expression, codon adaptation analysis tools should be applied to adjust the modified gene sequence to Y. pseudotuberculosis preferred codon usage while avoiding rare codons that might limit translation efficiency. Machine learning approaches trained on previous vaccine efficacy data can integrate these diverse parameters to rank candidate designs. This entire computational pipeline can be automated for high-throughput screening of thousands of potential uspB modifications, significantly accelerating the vaccine development process by prioritizing candidates most likely to succeed in subsequent experimental validation.

What are the key methodological lessons from previous attempts to develop Y. pseudotuberculosis-based vaccines?

Previous attempts to develop Y. pseudotuberculosis-based vaccines have yielded critical methodological insights that should guide future research. Attenuation strategy optimization has emerged as foundational - earlier approaches using single virulence gene deletions often resulted in either insufficient attenuation (causing safety concerns) or over-attenuation (reducing immunogenicity). The most successful approaches have employed targeted modifications of specific genes like yopJ and yopK combined with chromosomal integration of heterologous antigens, as demonstrated with the χ10068 strain . This balanced approach maintains sufficient immunostimulatory capacity while ensuring safety.

Antigen expression localization significantly impacts vaccine efficacy. Studies have consistently shown that surface-exposed or secreted antigens generate stronger protective immunity than cytoplasmic antigens. The approach of expressing the complete caf1R-caf1A-caf1M-caf1 operon resulted in properly assembled F1 antigen on the bacterial surface at 37°C , highlighting the importance of including chaperone and transport systems along with the antigen itself. Researchers should specifically design constructs with appropriate secretion signals and confirm surface localization through immunofluorescence microscopy.

Administration route optimization has revealed that oral delivery, which mimics the natural infection route of Y. pseudotuberculosis, generates robust mucosal immunity at both intestinal and respiratory surfaces. Studies demonstrated that a single oral dose of recombinant Y. pseudotuberculosis provided 70-90% protection against Y. pestis challenge , superior to parenteral immunization with the same strain. Researchers should employ gastric acid neutralization (typically with sodium bicarbonate) before oral administration to ensure bacterial survival through the stomach, and consider gastrointestinal sampling to confirm vaccine establishment in intestinal tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.