Recombinant Yersinia pseudotuberculosis serotype O:3 Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Gene and Regulatory Context

The argO gene is part of the chromosomal genome of Y. pseudotuberculosis serotype O:3 (strain YPIII). Its genomic neighborhood includes genes involved in amino acid metabolism and stress response, suggesting regulatory coordination under nutrient-limiting conditions .

Production and Purification

Recombinant ArgO is produced via heterologous expression in E. coli, followed by affinity chromatography using the His tag. Key parameters include:

ParameterSpecification
Purity>90% (verified by SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water with 50% glycerol for stability
StabilityStable at -80°C; sensitive to repeated freeze-thaw cycles

Functional and Research Applications

  • Metabolic Studies: ArgO facilitates arginine efflux, potentially modulating intracellular amino acid pools during infection .

  • Virulence Investigations: While not directly linked to virulence in Yersinia, arginine transport may influence survival in host environments .

  • Immunological Assays: Used as an antigen in ELISA to study antibody responses in Yersinia-infected hosts .

Comparative Analysis

ArgO homologs exist in other pathogens, including Salmonella and Escherichia coli, but the Y. pseudotuberculosis variant exhibits unique sequence features:

OrganismGene NameFunctionSequence Similarity
Y. pseudotuberculosis O:3YPK_0855Arginine exportReference
Salmonella agonaSeAg_B3228Amino acid transport68%
E. coli O157:H7-Hypothetical transporter52%

Research Significance and Gaps

Current studies focus on ArgO’s role in bacterial physiology, though direct links to Yersinia pathogenesis remain unexplored. Future work could address:

  • Structural determination (e.g., X-ray crystallography).

  • Impact of arginine export on host immune evasion.

  • Potential as a therapeutic target.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
argO; YPK_0855; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALAFLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
ArgO is involved in the export of arginine. It plays a crucial role in regulating intracellular arginine levels and maintaining the proper balance between arginine and lysine.
Database Links

KEGG: ypy:YPK_0855

Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Y. pseudotuberculosis serotype O:3 differ from other serotypes in pathophysiology?

While the search results don't specifically address serotype O:3 differences, Y. pseudotuberculosis generally causes self-limited mesenteric lymphadenitis that mimics appendicitis. The pathophysiology involves:

  • Initial colonization of the gastrointestinal tract, particularly Peyer's patches

  • Spread to liver and spleen through mesenteric lymph nodes

  • Formation of epithelioid granulomatous lesions with coagulative necrosis

  • Microabscess development in small bowel with cryptic hyperplasia and villi shortening

Y. pseudotuberculosis requires a large inoculum to cause disease and possesses plasmid-encoded proteins that increase invasiveness. A significant virulence factor is its siderophore-mediated iron scavenging system, making patients with iron overload conditions at higher risk for systemic infections .

What expression systems are most effective for producing recombinant Y. pseudotuberculosis proteins?

Based on general principles of recombinant protein expression:

Table 1: Expression Systems for Recombinant Y. pseudotuberculosis Proteins

Expression SystemAdvantagesLimitationsYield Potential
E. coli- Rapid growth
- Well-established protocols
- Cost-effective
- Potential folding issues
- Limited post-translational modifications
High
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic processing
- Moderate post-translational modifications
- Longer expression time
- More complex media requirements
Medium to High
Insect cells- Better folding of complex proteins
- Advanced post-translational modifications
- Higher cost
- More technical expertise required
Medium
Mammalian cells- Most sophisticated processing
- Native-like folding
- Highest cost
- Slowest growth
- Most complex protocols
Low to Medium

When expressing membrane proteins like ArgO, considerations should include codon optimization, fusion partners to enhance solubility, and detergent selection for extraction and purification. The choice between these systems would depend on the specific experimental requirements and downstream applications .

How does the structure-function relationship of ArgO compare to other bacterial amino acid exporters?

While specific structural data for ArgO from Y. pseudotuberculosis is not provided in the search results, we can analyze probable structural elements based on its function:

ArgO likely belongs to the amino acid exporter family with:

  • Multiple transmembrane domains forming a channel for arginine transport

  • Substrate binding domains with specificity for arginine

  • Energy coupling domains that harness cellular energy for active transport

Comparative analysis with better-characterized exporters suggests that ArgO may share structural similarities with other basic amino acid transporters. The protein potentially contains conserved motifs for substrate recognition and may undergo conformational changes during the transport cycle.

Research approaches to elucidate structure-function relationships should include:

  • Site-directed mutagenesis of predicted functional residues

  • Chimeric protein construction with other characterized transporters

  • Crystallization trials with and without substrate

  • In silico modeling based on homologous proteins with known structures

What role might ArgO play in the virulence mechanisms of Y. pseudotuberculosis?

ArgO's potential contribution to virulence may intersect with known pathogenicity factors of Y. pseudotuberculosis:

  • Metabolic adaptation: ArgO may facilitate bacterial survival in host environments by maintaining arginine homeostasis. Y. pseudotuberculosis requires specialized mechanisms to survive intracellularly, and ArgO could contribute to adaptation to the nutrient-limited intracellular environment .

  • Interaction with host immune responses: The search results indicate that Y. pseudotuberculosis produces immunomodulatory Yersinia outer proteins (Yops) that are crucial for bacterial survival by down-regulating anti-bacterial responses. While ArgO is not a Yop, its function in arginine export may indirectly influence these immunomodulatory processes .

  • Potential interaction with signaling pathways: Y. pseudotuberculosis manipulates host cell signaling through various mechanisms. For example, Yops affect Rho-GTPase signaling through four different mechanisms: acceleration of GTP conversion (YopE), inhibition of GDP dissociation (YopO), release of Rho-GTPases from the membrane (YopT), and deamidation of catalytic glutamine residues (CNF-Y). ArgO could potentially influence these or other signaling pathways by modulating local arginine concentrations .

To investigate these potential roles, researchers should consider:

  • Gene knockout studies comparing wild-type and ArgO-deficient strains

  • Host-pathogen interaction assays with varying arginine concentrations

  • Transcriptomic analysis to identify genes co-regulated with ArgO during infection

How does ArgO expression change under different environmental conditions relevant to infection?

To systematically investigate ArgO expression:

Table 2: Environmental Factors Affecting ArgO Expression

Environmental FactorExpected Effect on ArgO ExpressionExperimental Approach
Temperature shifts (37°C vs. environmental temperature)Potential upregulation at host temperatureqRT-PCR, Western blot analysis under controlled temperature conditions
pH variation (gastric acid to intestinal pH)Expression changes corresponding to intestinal colonizationpH-controlled growth media with expression monitoring
Nutrient limitation (especially arginine)Likely upregulation during arginine starvationGrowth in defined media with varied arginine concentrations
Host cell proximityPossible expression changes during host cell contactCo-culture systems with host cells, single-cell analysis techniques
Iron availabilityMay correlate with siderophore expressionChelated media experiments, comparison with iron-regulated genes

Y. pseudotuberculosis is known to have enhanced growth characteristics in cold temperatures, with most cases occurring in winter . This suggests sophisticated environmental adaptation mechanisms that may include ArgO regulation. The bacterium's ability to survive in diverse environments (soil, farm-produced plants, root vegetables, and animal reservoirs) indicates complex regulatory networks that respond to environmental cues .

What are the optimal conditions for expressing and purifying recombinant ArgO protein?

Expression optimization protocol:

  • Vector selection: Choose vectors with inducible promoters (T7, tac) for controlled expression.

  • Host strain selection: For membrane proteins like ArgO, consider E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)).

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Induction: Use lower inducer concentrations for longer periods

    • Media: Enriched media (TB, 2YT) supplemented with appropriate antibiotics

  • Purification strategy:

Table 3: Purification Strategy for Recombinant ArgO

StepMethodologyBuffer CompositionConsiderations
Cell lysisMechanical disruption (French press/sonication)50 mM Tris-HCl pH 7.5, 150 mM NaCl, protease inhibitorsGentle lysis to preserve membrane integrity
Membrane isolationUltracentrifugation (100,000 × g)Same as lysis bufferSeparate membrane fraction from cytosolic proteins
SolubilizationDetergent extractionLysis buffer + detergent (DDM, LDAO, or C12E8)Screen multiple detergents for optimal extraction
Affinity purificationIMAC (for His-tagged protein)Solubilization buffer + 20-50 mM imidazoleStep gradient elution to minimize contaminants
Size exclusionGel filtration20 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.02% detergentAssess protein homogeneity and remove aggregates
  • Functional validation:

    • Transport assays using proteoliposomes

    • Binding assays with radiolabeled or fluorescent arginine

    • Structural integrity assessment via circular dichroism

The approach should be tailored based on the specific experimental aims and downstream applications .

What controls and validation steps are essential when studying ArgO interactions with host cell components?

A systematic approach to studying ArgO-host interactions should include:

  • Essential controls:

    • Negative controls: Expression vector without ArgO insert

    • Positive controls: Known bacterial-host interaction systems

    • Specificity controls: Homologous proteins from non-pathogenic species

    • Functional mutants: ArgO with mutations in key functional domains

  • Validation methodology:

    • Co-immunoprecipitation with reciprocal pull-downs

    • Proximity labeling techniques (BioID, APEX)

    • Fluorescence microscopy for co-localization studies

    • Surface plasmon resonance for binding kinetics

  • Physiological relevance assessment:

    • Infection models with ArgO knockout strains

    • Complementation studies with wild-type vs. mutant ArgO

    • Host cell phenotype analysis upon ArgO exposure

  • Data interpretation framework:

    • Distinguish direct from indirect interactions

    • Quantify interaction strength under different conditions

    • Determine specificity through competition assays

    • Correlate molecular interactions with functional outcomes

  • Technical considerations:

    • Tag position and size can affect protein function (similar to considerations for YopM where structure and function are tightly linked)

    • Detergent choice influences membrane protein stability and interaction properties

    • Expression levels should mimic physiological conditions

    • Host cell type selection should reflect natural infection targets

How can RNA-Seq data be optimally analyzed to understand ArgO regulation in different infection stages?

Comprehensive RNA-Seq analysis workflow:

  • Experimental design considerations:

    • Multiple time points representing different infection stages

    • Biological replicates (minimum n=3)

    • Multiple infection conditions (in vitro, ex vivo, in vivo)

    • Controls for each condition

  • Quality control and preprocessing:

    • Raw read quality assessment (FastQC)

    • Adapter and quality trimming (Trimmomatic, Cutadapt)

    • rRNA depletion verification

  • Alignment and quantification:

    • Map to Y. pseudotuberculosis reference genome

    • Simultaneously map to host genome for dual RNA-Seq

    • Quantify with feature-specific tools (featureCounts, HTSeq)

  • Differential expression analysis:

    • Apply appropriate statistical models (DESeq2, edgeR)

    • Account for batch effects and technical variation

    • Use multiple testing correction (Benjamini-Hochberg)

  • ArgO-focused analysis:

Table 4: RNA-Seq Analysis Methods for ArgO Regulation Studies

Analysis TypePurposeTools/MethodsOutput Interpretation
Co-expression networkIdentify genes co-regulated with ArgOWGCNA, CEMiToolModules of functionally related genes
Pathway enrichmentConnect ArgO to biological processesGSEA, KEGG analysisPathways over-represented in co-expressed genes
Transcription factor bindingIdentify potential ArgO regulatorsMEME, HOMERMotifs enriched in promoters of co-regulated genes
Comparative genomicsArgO regulation across Yersinia speciesOrthoMCL, RoaryConservation of regulatory networks
Time-course analysisDynamic expression patternsmaSigPro, ImpulseDE2Temporal regulation patterns
  • Integration with other data types:

    • Correlate with proteomics data

    • Link to phenotypic observations

    • Integrate with ChIP-Seq for direct regulation evidence

Y. pseudotuberculosis is known to have complex virulence mechanisms , and understanding ArgO regulation within this context requires sophisticated bioinformatic approaches to extract meaningful patterns from RNA-Seq data.

How can contradictory results between in vitro and in vivo ArgO studies be reconciled?

When facing contradictory results between in vitro and in vivo studies:

  • Systematic analysis of differences:

    • Map all experimental variables between systems

    • Identify specific conflicting observations

    • Determine if contradictions are complete or contextual

  • Biological explanations to consider:

    • Microenvironment differences (pH, nutrients, host factors)

    • Temporal dynamics of infection not captured in vitro

    • Host immune factor interactions absent in simplified systems

    • Bacterial population heterogeneity in vivo

  • Technical reconciliation approaches:

    • Develop intermediate models (ex vivo, organoids)

    • Design experiments to specifically test hypothesized reasons for discrepancies

    • Use multiple complementary techniques to observe the same phenomenon

    • Isolate specific variables for controlled comparative studies

  • Interpretation framework:

    • Consider both results as potentially valid in their specific contexts

    • Develop conditional models that explain when each result applies

    • Identify environmental triggers that might switch between phenotypes

  • Case study approach: Taking lessons from Yersinia research, we know that prolonged action of virulence factors like YopE can have opposing effects—initially suppressing immune responses but later potentially triggering sensing as a danger signal by macrophages, leading to increased bacterial killing . Similarly, ArgO function might have context-dependent effects that appear contradictory when observed in different experimental settings.

What strategies can address low ArgO protein yield and stability issues?

Low yield and stability are common challenges with membrane proteins like ArgO. Consider these strategies:

Table 5: Troubleshooting Strategies for ArgO Expression and Stability

IssuePotential CausesSolution StrategiesExpected Outcomes
Low expression yieldToxicity to host cells- Use tightly regulated expression systems
- Lower induction levels
- Use specialized host strains (C41/C43)
Improved cell viability with detectable protein expression
Codon bias- Codon optimization for expression host
- Supply rare tRNAs (Rosetta strains)
Enhanced translation efficiency
Protein misfolding- Reduce expression temperature (16-20°C)
- Add folding enhancers (glycerol, specific ions)
- Co-express chaperones
Increased proportion of correctly folded protein
Poor stabilityDetergent incompatibility- Screen detergent panel (DDM, LMNG, GDN)
- Test detergent mixtures
- Consider nanodiscs or SMALPs
Extended protein stability
Oxidation sensitivity- Include reducing agents (DTT, BME)
- Conduct operations under nitrogen
- Use oxygen-scavenging systems
Prevention of oxidative damage
Protease susceptibility- Add multiple protease inhibitors
- Identify and modify protease-sensitive sites
- Remove flexible regions
Reduced degradation during purification
AggregationConcentration-dependent issues- Maintain below critical concentration
- Include stabilizing additives (glycerol, arginine)
- Optimize buffer ionic strength
Maintenance of monodisperse protein

How can researchers distinguish between ArgO-specific effects and general bacterial stress responses in host-pathogen experiments?

Differentiating ArgO-specific effects from general stress responses requires:

  • Genetic approaches:

    • Clean deletion mutants (ΔargO) with complementation controls

    • Point mutations affecting specific ArgO functions

    • Conditional expression systems (inducible, temperature-sensitive)

    • Heterologous expression of ArgO in non-pathogenic bacteria

  • Biochemical verification:

    • Direct activity assays measuring arginine transport

    • ArgO-specific antibodies for localization studies

    • Pull-down assays to identify specific interaction partners

    • Metabolic profiling focused on arginine pathways

  • Comparative analysis:

    • Parallel assessment of mutants in related transporters

    • Cross-species comparisons with homologous systems

    • Global stress response profiling (transcriptomics, proteomics)

    • Temporal resolution of responses (immediate vs. delayed)

  • Host response dissection:

    • Measure specific vs. general immune markers

    • Single-cell analysis to identify responding cell populations

    • Pathway inhibition to block specific signaling cascades

    • In vitro reconstitution with purified components

  • Key distinction criteria:

    • Temporal specificity (immediate vs. delayed)

    • Dose-response relationships

    • Genetic epistasis analysis

    • Biochemical specificity (direct measurement of arginine levels)

These approaches can be informed by studies on Yersinia virulence factors, where researchers have carefully dissected specific effects of proteins like YopE, YopO, and YopT on host signaling pathways .

What emerging technologies could advance our understanding of ArgO structure and function?

Several cutting-edge technologies hold promise for ArgO research:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structures

    • Tomography for in situ visualization of ArgO in membranes

    • Time-resolved studies to capture transport cycle intermediates

  • Advanced spectroscopy:

    • Solid-state NMR for membrane protein structural analysis

    • EPR spectroscopy with site-directed spin labeling for conformational dynamics

    • Mass spectrometry methods (HDX-MS, XL-MS) for structural mapping

  • Computational approaches:

    • AI-based structure prediction (AlphaFold2, RoseTTAFold)

    • Molecular dynamics simulations of transport mechanisms

    • Systems biology modeling of arginine homeostasis networks

  • Single-molecule techniques:

    • FRET studies of conformational changes during transport

    • Electrical recordings of single-transporter activity

    • Force spectroscopy to measure substrate binding energetics

  • In situ techniques:

    • Proximity labeling (TurboID, APEX) in living bacteria

    • Super-resolution microscopy for localization in bacterial membranes

    • Correlative light and electron microscopy for contextual analysis

The integration of these technologies could reveal how ArgO's structure enables its function and how it contributes to the sophisticated pathogenicity mechanisms of Y. pseudotuberculosis .

How might ArgO research contribute to novel antimicrobial strategies against Y. pseudotuberculosis?

ArgO research could inform antimicrobial development through several avenues:

  • Direct targeting strategies:

    • Small molecule inhibitors of ArgO transport function

    • Peptide mimetics that compete for substrate binding

    • Allosteric modulators affecting conformational changes

    • Antibodies or nanobodies targeting extracellular loops

  • Metabolic vulnerability exploitation:

    • Manipulation of arginine availability to stress bacterial metabolism

    • Development of toxic arginine analogs transported by ArgO

    • Targeting of arginine-dependent virulence mechanisms

    • Combination with other metabolic pathway inhibitors

  • Host-directed therapeutics:

    • Modulation of host arginine metabolism to create unfavorable conditions

    • Enhancement of host defense mechanisms affected by ArgO function

    • Blocking of host-pathogen interfaces where ArgO plays a role

    • Immunomodulatory approaches targeting ArgO-affected pathways

  • Translational potential assessment:

    • Evaluation of ArgO conservation across Yersinia strains and related pathogens

    • Consideration of resistance development mechanisms

    • Host toxicity and specificity profiling

    • Delivery challenges for targeting bacteria in diverse niches

The fluoroquinolone group of drugs has been found to be most effective in treating Y. pseudotuberculosis infections , but emerging resistance necessitates new approaches. ArgO-targeted strategies could provide novel mechanisms to overcome resistance while potentially reducing collateral damage to the host microbiome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.