Recombinant Yersinia pseudotuberculosis serotype O:3 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; YPK_1027; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
aas
Target Protein Sequence
MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKAARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium ions. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: ypy:YPK_1027

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis and what role does it play in pathogenesis?

Yersinia pseudotuberculosis is a Gram-negative enteropathogen that causes gastrointestinal infections in humans and animals. Its pathogenicity stems from its ability to disseminate from the gut to mesenteric lymph nodes (MLNs), spleen, and liver of infected hosts. This dissemination process is a critical aspect of Y. pseudotuberculosis virulence and depends on several molecular mechanisms, including the interaction between lipopolysaccharide (LPS) core oligosaccharide and CD209 receptors on host cells. These interactions contribute significantly to the bacteria's ability to spread through the host organism and establish infection in multiple tissues .

How does Y. pseudotuberculosis adapt during infection progression?

Y. pseudotuberculosis undergoes significant transcriptional reprogramming during the course of infection, transitioning from a virulent phenotype during early infection to an adapted persistent mode in later stages. During early infection (approximately 2 days post-infection), the bacterium expresses virulence genes, including those encoding the Type III Secretion System (T3SS), which is crucial for colonization of host tissues, breaching the epithelial barrier, and resisting neutrophil attacks. As the infection progresses to a persistent stage (around 42 days post-infection), Y. pseudotuberculosis reprograms its transcriptome by reducing the expression of T3SS components and increasing the expression of genes important for survival in the cecal lymphoid compartment .

This reprogramming is evidenced by functional annotation of upregulated genes during different infection stages:

Infection StageUpregulated PathwaysFunctional Significance
Early (2 dpi)Virulence factors, T3SSTissue colonization, immune evasion
Persistent (42 dpi)Metabolic adaptation genes, flagellar genesLong-term survival, potential dissemination

The bacteria remain flagellated during persistent infection, which may facilitate spread to other hosts through shedding into feces .

What methodologies are most effective for expressing and purifying recombinant Y. pseudotuberculosis Bifunctional Protein Aas?

For optimal expression and purification of recombinant Y. pseudotuberculosis Bifunctional Protein Aas, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli is the preferred expression system for this protein, as demonstrated in successful recombinant production. BL21(DE3) or other protease-deficient strains are recommended to minimize degradation during expression .

  • Vector Design: Incorporate an N-terminal His-tag for affinity purification. The complete coding sequence (1-718 amino acids) should be optimized for codon usage in E. coli to enhance expression efficiency.

  • Expression Conditions:

    • Induce expression at OD600 = 0.6-0.8 with IPTG (0.5-1 mM)

    • Lower induction temperature (16-20°C) for 18-24 hours to improve solubility

    • Supplement growth media with additional zinc ions if required for proper folding

  • Purification Protocol:

    • Lyse cells using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

    • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Include a size exclusion chromatography step to remove aggregates and ensure monodispersity

    • Lyophilize the purified protein in the presence of suitable stabilizers if long-term storage is required

This approach typically yields 2-5 mg of purified protein per liter of bacterial culture with >90% purity as assessed by SDS-PAGE.

How does the bifunctional nature of Aas protein contribute to Y. pseudotuberculosis pathogenicity?

The bifunctional nature of the Aas protein represents a sophisticated evolutionary adaptation that enhances Y. pseudotuberculosis pathogenicity through multiple mechanisms. By combining two enzymatic functions in a single protein, Y. pseudotuberculosis optimizes its metabolic efficiency while enhancing virulence capabilities.

Based on structural and functional analysis of similar bifunctional proteins, the Aas protein likely contributes to pathogenicity through:

  • Cell Wall Modification: Similar to alanine racemase in other bacteria, one function of the Aas protein may involve peptidoglycan biosynthesis, potentially catalyzing racemization reactions that are critical for bacterial cell wall integrity. This activity would provide structural resilience against host defense mechanisms and antibiotics .

  • Lipid Metabolism Regulation: The second function may involve fatty acid biosynthesis or membrane lipid composition modification, which can alter bacterial membrane permeability and interaction with host cells.

  • Host-Pathogen Interaction Modulation: The protein may participate in LPS core modifications that facilitate interactions with CD209 receptors on dendritic cells and other antigen-presenting cells. This interaction is crucial for Y. pseudotuberculosis dissemination from the gut to mesenteric lymph nodes, as demonstrated in related research .

  • Adaptation to Environmental Changes: The bifunctional nature may enable rapid adaptation to changing environmental conditions during infection progression, supporting the transition from acute to persistent infection phases observed in Y. pseudotuberculosis .

The integration of these functions in a single protein represents an elegant evolutionary solution that enhances bacterial fitness during infection and potentially contributes to immune evasion strategies.

What are the key considerations for designing inhibitors targeting the Bifunctional Protein Aas?

Designing effective inhibitors against the Bifunctional Protein Aas requires a comprehensive understanding of both its structural features and catalytic mechanisms. Based on current knowledge of bifunctional enzymes like alanine racemase, researchers should consider these strategic approaches:

  • Dual-Target Inhibition Strategy: Given the bifunctional nature of the protein, effective inhibitors should ideally target both functional domains to prevent compensatory mechanisms. This approach requires:

    • Identification of catalytic residues in both active sites through structural analysis and site-directed mutagenesis

    • Development of bivalent inhibitors that can simultaneously engage both active sites

  • Structure-Based Design Considerations:

    • Target substrate-binding pockets identified through homology modeling and molecular docking studies

    • Focus on conserved motifs that are essential for catalytic activity but differ from human homologs

    • Consider allosteric inhibition approaches to modulate protein function indirectly

  • Experimental Validation Pipeline:

    StageTechniquesExpected Outcomes
    Initial ScreeningIn silico molecular docking, fluorescence-based enzyme assaysIdentification of lead compounds with IC50 < 10 μM
    Mechanism ValidationIsothermal titration calorimetry, X-ray crystallographyBinding mode confirmation and affinity determination
    Specificity TestingCounter-screening against homologous human enzymesSelectivity index > 100 for bacterial vs. human targets
    Cellular ActivityMinimum inhibitory concentration (MIC) determinationEffective bacterial growth inhibition at < 5 μg/mL
  • Resistance Development Mitigation: Design inhibitors that target highly conserved regions essential for protein function to minimize the development of resistance mutations .

  • Delivery Optimization: Consider the necessity of the inhibitor to penetrate the Gram-negative outer membrane of Y. pseudotuberculosis, potentially through conjugation with siderophores or other bacterial uptake mechanisms.

This systematic approach maximizes the probability of developing potent and selective inhibitors against this important virulence factor.

How can homology modeling be utilized to predict the structure and function of Y. pseudotuberculosis Bifunctional Protein Aas?

Homology modeling represents a powerful approach for predicting the three-dimensional structure of Y. pseudotuberculosis Bifunctional Protein Aas when experimental structures are unavailable. The methodology should follow these systematic steps:

  • Template Identification and Selection:

    • Perform sequence similarity searches using BLAST against the Protein Data Bank (PDB)

    • Select templates with highest sequence identity (preferably >30%) and coverage

    • For bifunctional proteins, multiple templates may be required for different domains

  • Sequence Alignment Optimization:

    • Perform multiple sequence alignment including the target and template sequences

    • Manually refine alignments, particularly in catalytic regions and domain interfaces

    • Verify conservation of critical residues across homologous proteins

  • Model Building and Refinement:

    • Generate multiple models using platforms such as Swiss-Model, Phyre2, or MODELLER

    • Refine models through energy minimization and molecular dynamics simulations

    • Validate structural quality using Ramachandran plots to assess phi (Φ) and psi (ψ) dihedral angles of amino acid residues

  • Model Validation:

    • Assess stereochemical quality using PROCHECK or MolProbity

    • Evaluate energy profiles using tools like PROSA or VERIFY3D

    • Target >90% residues in favored regions of Ramachandran plot for high-quality models

  • Functional Site Prediction:

    • Identify potential active sites using CASTp or SiteMap

    • Compare with known functional sites in template structures

    • Validate through virtual docking of known substrates or inhibitors

The successful application of this methodology has been demonstrated for other bifunctional enzymes like alanine racemase from Taibaiella chishuiensis, where homology modeling revealed conserved active sites and binding regions that could be targeted for antimicrobial development .

What experimental approaches can be used to study the dual functionality of the Aas protein?

Investigating the dual functionality of the Aas protein requires a multi-faceted experimental approach that combines biochemical, structural, and genetic techniques:

  • Domain Mapping and Mutagenesis:

    • Construct truncation variants to isolate individual functional domains

    • Perform site-directed mutagenesis of predicted catalytic residues

    • Assess activity of wild-type and mutant proteins using specific enzymatic assays

  • Activity Assays for Bifunctional Characterization:

    • Develop coupled enzymatic assays to monitor both functions simultaneously

    • Measure kinetic parameters (kcat, Km) for each activity under various conditions

    • Investigate potential regulatory crosstalk between the two functional domains

  • Structural Studies:

    • Employ X-ray crystallography or cryo-electron microscopy to determine 3D structure

    • Perform substrate/inhibitor co-crystallization to identify binding sites

    • Use hydrogen-deuterium exchange mass spectrometry to analyze conformational dynamics

  • In Vivo Functional Analysis:

    • Generate knockout and complementation strains in Y. pseudotuberculosis

    • Assess phenotypic changes in virulence, persistence, and metabolism

    • Perform transcriptomic and proteomic analyses to identify affected pathways

  • Protein-Protein Interaction Studies:

    • Identify interaction partners using pull-down assays coupled with mass spectrometry

    • Validate interactions using techniques such as bioluminescence resonance energy transfer (BRET)

    • Map interaction interfaces through crosslinking and peptide mapping

  • Comparative Analysis Across Bacterial Species:

    • Examine conservation of bifunctional properties in homologous proteins

    • Assess evolutionary relationships and potential horizontal gene transfer events

    • Compare mechanism of action with similar bifunctional proteins in other pathogens

These approaches collectively provide a comprehensive understanding of how the dual functionality contributes to bacterial physiology and pathogenesis, potentially revealing new targets for therapeutic intervention.

How can transcriptional reprogramming of Y. pseudotuberculosis be studied in relation to Aas protein expression?

Investigating the relationship between transcriptional reprogramming and Aas protein expression in Y. pseudotuberculosis requires integration of multiple advanced techniques:

  • Temporal Transcriptome Analysis:

    • Perform RNA sequencing (RNA-seq) at different infection stages (e.g., 2 days and 42 days post-infection)

    • Compare gene expression profiles between virulent and persistent phases

    • Identify co-regulated gene clusters that include the aas gene

    • Correlate aas expression patterns with specific infection stages

  • Promoter Analysis and Regulation Studies:

    • Clone the aas promoter region into reporter constructs (e.g., luciferase or GFP)

    • Identify transcription factor binding sites through chromatin immunoprecipitation (ChIP-seq)

    • Perform electrophoretic mobility shift assays (EMSA) to validate specific protein-DNA interactions

    • Conduct promoter mutagenesis to identify critical regulatory elements

  • Environmental Response Characterization:

    • Expose bacteria to conditions mimicking different infection stages (pH, oxygen tension, nutrient availability)

    • Monitor aas expression under aerobic versus anaerobic conditions

    • Assess the influence of host factors (e.g., antimicrobial peptides, immune cells) on aas expression

  • Genetic Manipulation Approaches:

    • Construct conditional knockdown/overexpression systems for aas

    • Generate mutants in key regulatory genes (arcA, fnr, etc.) known to be involved in Y. pseudotuberculosis persistence

    • Perform complementation studies to confirm phenotypic effects

  • Single-Cell Analysis:

    • Use fluorescent reporters to monitor aas expression at the single-cell level

    • Identify potential heterogeneity in expression within bacterial populations

    • Correlate expression patterns with bacterial morphology and division status

  • Integration with Metabolomic Data:

    • Profile metabolic changes associated with Aas activity during different infection phases

    • Correlate metabolite levels with transcriptional changes

    • Develop metabolic flux models to predict the impact of Aas activity on bacterial physiology

These methodologies collectively provide a comprehensive view of how Y. pseudotuberculosis regulates aas expression during its transition from virulent to persistent infection states, potentially revealing new targets for disrupting this adaptation process.

How can structural information about Bifunctional Protein Aas inform vaccine development against Y. pseudotuberculosis?

Structural insights into the Bifunctional Protein Aas offer valuable opportunities for rational vaccine design against Y. pseudotuberculosis through several strategic approaches:

  • Epitope Identification and Selection:

    • Perform computational epitope prediction using the complete amino acid sequence

    • Prioritize epitopes based on:

      • Surface accessibility (exposed regions more likely to be recognized by antibodies)

      • Sequence conservation across Y. pseudotuberculosis strains

      • Low homology to human proteins to minimize autoimmunity risk

      • Predicted MHC binding affinity for both class I and II molecules

  • Structural Vaccinology Approach:

    • Focus on conformational epitopes that span functional domains

    • Design immunogens that present epitopes in their native three-dimensional context

    • Employ structure-based design to create stable, soluble protein fragments containing key epitopes

  • Adjuvant Selection and Formulation:

    • Test multiple adjuvant systems to enhance immune response against selected epitopes

    • Consider mucosal adjuvants to target the primary site of Y. pseudotuberculosis infection

  • Experimental Validation Pipeline:

    Development StageMethodologiesKey Endpoints
    Epitope ValidationPeptide synthesis, ELISA, flow cytometryAntibody binding affinity, T-cell activation
    Immunogenicity AssessmentMouse immunization studiesAntibody titers, T-cell responses, memory formation
    Functional AnalysisOpsonophagocytic assays, neutralization testsAntibody-mediated bacterial clearance, enzyme inhibition
    Protection StudiesChallenge experiments in animal modelsSurvival rates, bacterial load reduction, disease severity
  • Multi-Epitope Vaccine Design:

    • Combine epitopes from Aas with other virulence determinants for broader protection

    • Create recombinant constructs linking multiple epitopes with appropriate spacers

    • Test various delivery platforms (protein subunit, viral vectors, DNA vaccines)

  • Cross-Protection Potential:

    • Assess conservation of Aas across related Yersinia species

    • Evaluate potential cross-protection against Y. enterocolitica and Y. pestis

    • Identify broadly protective epitopes conserved across multiple pathogens

By leveraging structural information about the Bifunctional Protein Aas, researchers can develop vaccines that specifically target functional regions critical for Y. pseudotuberculosis virulence and persistence, potentially providing effective protection against this important pathogen.

What are the most promising approaches for monitoring Aas protein activity in live bacterial cultures during infection studies?

Monitoring Aas protein activity in live bacterial cultures during infection studies requires sophisticated approaches that combine molecular biology, imaging techniques, and biochemical assays:

  • Reporter Fusion Systems:

    • Generate translational fusions of Aas with fluorescent proteins (e.g., GFP, mCherry)

    • Develop split reporter systems where protein activity reconstitutes fluorescence

    • Ensure reporter fusion does not interfere with protein localization or function

    • Monitor expression levels and localization patterns during different infection phases

  • Activity-Based Protein Profiling (ABPP):

    • Design activity-based probes that specifically target the catalytic sites of Aas

    • Label active protein using bioorthogonal chemistry approaches (click chemistry)

    • Visualize activity patterns using fluorescence microscopy or flow cytometry

    • Quantify activity levels across bacterial populations during infection

  • Biosensor Development:

    • Create FRET-based biosensors that respond to Aas substrate turnover

    • Design genetic circuits where Aas activity triggers reporter gene expression

    • Develop metabolite sensors that detect products of Aas-catalyzed reactions

    • Implement these systems in Y. pseudotuberculosis strains for in vivo studies

  • In Situ Enzymatic Assays:

    • Adapt traditional enzyme activity assays for use in live bacterial cultures

    • Develop fluorogenic or chromogenic substrates that can penetrate bacterial cells

    • Optimize assay conditions to maintain bacterial viability while measuring activity

    • Correlate activity levels with bacterial physiological states

  • Mass Spectrometry-Based Approaches:

    • Implement SAMDI-MS (self-assembled monolayers for matrix-assisted laser desorption/ionization mass spectrometry) for activity monitoring

    • Use stable isotope labeling to track metabolic flux through Aas-dependent pathways

    • Develop targeted metabolomics approaches to monitor Aas substrate/product levels

  • Microfluidic Single-Cell Analysis:

    • Design microfluidic devices for real-time monitoring of bacterial responses

    • Implement time-lapse imaging to track Aas activity throughout infection cycles

    • Correlate protein activity with phenotypic changes at the single-cell level

    • Combine with host cell co-culture systems to assess activity during host-pathogen interactions

These approaches provide complementary information about Aas protein activity, enabling researchers to understand its dynamic regulation during different stages of infection and in response to various environmental stressors.

How can systems biology approaches integrate Aas protein function into the broader context of Y. pseudotuberculosis pathogenesis?

Systems biology approaches offer powerful frameworks for contextualizing Aas protein function within the complex pathogenesis mechanisms of Y. pseudotuberculosis:

These systems biology approaches provide a comprehensive framework for understanding how Aas protein function integrates with broader cellular processes, contributing to our understanding of Y. pseudotuberculosis pathogenesis and potentially revealing new therapeutic strategies.

How might CRISPR-Cas9 gene editing be applied to study Aas protein function in Y. pseudotuberculosis?

CRISPR-Cas9 gene editing technologies offer unprecedented precision for investigating Aas protein function in Y. pseudotuberculosis through several advanced experimental strategies:

  • Precision Gene Knockout and Knockdown:

    • Design guide RNAs targeting specific regions of the aas gene

    • Generate complete gene knockouts to assess essentiality and phenotypic consequences

    • Implement CRISPRi (CRISPR interference) for conditional knockdown when complete deletion is lethal

    • Create libraries of guide RNAs targeting different regions to identify critical domains

  • Domain-Specific Mutagenesis:

    • Use CRISPR-Cas9 with homology-directed repair to introduce specific mutations

    • Target catalytic residues separately in each functional domain to dissect bifunctionality

    • Create precise mutations that affect one function while preserving the other

    • Generate allelic series with varying degrees of functional impairment

  • Genomic Tagging and Fusion Proteins:

    • Insert fluorescent protein tags at the endogenous locus to monitor expression and localization

    • Add epitope tags for immunoprecipitation and protein interaction studies

    • Create reporter fusions that maintain native regulation and expression levels

    • Implement split protein complementation assays to study protein-protein interactions

  • Regulatory Element Editing:

    • Target promoter regions to modify transcriptional regulation

    • Edit ribosome binding sites to modulate translation efficiency

    • Modify potential regulatory sequence elements to study post-transcriptional control

    • Create reporter constructs to monitor promoter activity under different conditions

  • Base Editing and Prime Editing Applications:

    • Use cytosine or adenine base editors for precise single nucleotide modifications

    • Implement prime editing to introduce specific changes without double-strand breaks

    • Create specific codon changes to alter protein properties while maintaining expression

    • Introduce synonymous mutations to study effects on mRNA structure and translation

  • Screening and Selection Strategies:

    • Develop CRISPR screens to identify genetic interactions with aas

    • Create libraries targeting genes potentially involved in Aas regulation

    • Implement positive and negative selection schemes to identify mutations affecting virulence

    • Combine with in vivo infection models to identify mutations that alter persistence

  • Methodology Optimization for Y. pseudotuberculosis:

    Technical AspectOptimization ApproachExpected Outcome
    Delivery MethodElectroporation protocol optimization>80% transformation efficiency
    Guide RNA DesignAlgorithm incorporation of Y. pseudotuberculosis genome featuresReduced off-target effects
    Cas9 ExpressionTemperature-sensitive promoters, inducible systemsControlled editing activity
    Repair Template DesignOptimization of homology arm lengthEnhanced HDR efficiency

These CRISPR-based approaches provide powerful tools for dissecting the complex functions of the Aas protein in Y. pseudotuberculosis, enabling unprecedented insights into its role in bacterial physiology and pathogenesis.

What are the implications of using Aas protein as a biomarker for Y. pseudotuberculosis detection in clinical and environmental samples?

The Bifunctional Protein Aas presents significant potential as a biomarker for detecting Y. pseudotuberculosis in clinical and environmental samples, offering several advantages and considerations for diagnostic development:

  • Biomarker Specificity Considerations:

    • Analyze sequence conservation of Aas across Yersinia species and related pathogens

    • Identify unique epitopes or sequence regions specific to Y. pseudotuberculosis serotype O:3

    • Evaluate cross-reactivity with other bacterial species commonly found in clinical samples

    • Determine expression levels under different environmental conditions to ensure detection reliability

  • Detection Method Development:

    • Design highly specific monoclonal antibodies targeting Y. pseudotuberculosis Aas protein

    • Develop sandwich ELISA assays with optimized sensitivity for clinical applications

    • Create lateral flow immunoassays for rapid point-of-care testing

    • Implement multiplex detection systems combining Aas with other Y. pseudotuberculosis biomarkers

  • Nucleic Acid-Based Detection:

    • Design PCR primers targeting unique regions of the aas gene

    • Develop quantitative PCR assays with appropriate internal controls

    • Implement isothermal amplification methods (LAMP, RPA) for field-deployable testing

    • Design CRISPR-Cas12/13-based detection systems for ultrasensitive detection

  • Performance Characteristics for Clinical Applications:

    Performance ParameterTarget SpecificationValidation Approach
    Analytical Sensitivity<100 CFU/mLSpike-in experiments with clinical matrices
    Analytical Specificity>99%Testing against panel of related and unrelated bacteria
    Clinical Sensitivity>95%Comparison with culture-based gold standard
    Clinical Specificity>98%Testing in population with low disease prevalence
    Time-to-Result<60 minutesProcess optimization and validation
  • Environmental Monitoring Applications:

    • Develop sample preparation protocols for complex environmental matrices

    • Implement enrichment steps to enhance detection from low bacterial concentrations

    • Create automated sampling and detection systems for continuous monitoring

    • Validate methods across different environmental conditions (temperature, pH, etc.)

  • Translational Challenges and Solutions:

    • Address protein stability issues through addition of preservatives in collection media

    • Develop lyophilized reagents for improved shelf-life in resource-limited settings

    • Implement quality control procedures to ensure reproducible results

    • Design user-friendly interfaces for result interpretation by non-specialists

  • Integration with Existing Surveillance Systems:

    • Develop data reporting protocols compatible with public health surveillance networks

    • Create algorithms for interpreting results in the context of epidemiological data

    • Design studies to establish baseline prevalence in different geographical regions

    • Implement continuous monitoring programs in high-risk environments

The development of Aas-based detection methods could significantly enhance our ability to identify Y. pseudotuberculosis infections earlier and monitor environmental reservoirs, potentially improving both clinical outcomes and public health responses to outbreaks.

What are the most significant knowledge gaps in our understanding of Y. pseudotuberculosis Bifunctional Protein Aas?

Despite advances in our understanding of the Y. pseudotuberculosis Bifunctional Protein Aas, several critical knowledge gaps remain that warrant focused research attention:

Addressing these knowledge gaps through integrated structural, biochemical, genetic, and translational research approaches will significantly advance our understanding of this important bifunctional protein and potentially lead to new strategies for detecting, preventing, and treating Y. pseudotuberculosis infections.

How might future research on Bifunctional Protein Aas contribute to broader understanding of bacterial pathogenesis mechanisms?

Future research on the Y. pseudotuberculosis Bifunctional Protein Aas has the potential to make significant contributions to our broader understanding of bacterial pathogenesis through several conceptual and methodological advances:

  • Paradigms of Functional Protein Evolution:

    • Elucidate how bifunctional proteins evolve from single-function ancestors

    • Understand the evolutionary advantages of combining multiple functions in a single protein

    • Explore how functional consolidation contributes to metabolic efficiency during pathogenesis

    • Investigate the trade-offs between functional specialization and integration in bacterial adaptation

  • Models of Bacterial Persistence and Adaptation:

    • Clarify the role of bifunctional proteins in facilitating transitions between acute and persistent infection states

    • Develop more comprehensive models of how bacteria reprogram their physiology during long-term host colonization

    • Identify common molecular switches that regulate virulence-persistence transitions across bacterial pathogens

    • Establish new paradigms for targeting persistent bacterial infections

  • Host-Pathogen Interaction Networks:

    • Expand our understanding of how bacterial proteins interact with host immune receptors

    • Identify novel mechanisms by which pathogens exploit host defense systems for dissemination

    • Develop more sophisticated models of the molecular dialogue between pathogens and host cells

    • Understand how multifunctional bacterial proteins may engage with multiple host targets

  • Systems Approaches to Infection Biology:

    • Establish new methodologies for integrating protein function into whole-organism infection models

    • Develop computational frameworks for predicting the phenotypic consequences of protein modifications

    • Create more robust approaches for analyzing the complex dynamics of host-pathogen interactions

    • Implement advanced imaging and analytical techniques for tracking protein activity during infection

  • Translational Impact on Multiple Fields:

    Research AreaPotential ContributionsBroader Significance
    Antimicrobial DevelopmentNovel target validation, resistance mechanism insightsAddressing the antimicrobial resistance crisis
    Vaccine DesignNew antigen delivery strategies, adjuvant developmentImproving prevention of bacterial infections
    Diagnostic InnovationBiomarker discovery, multiplexed detection approachesEnhancing rapid and specific pathogen identification
    Synthetic BiologyBifunctional protein design principles, metabolic engineeringCreating novel biosynthetic pathways and sensors
  • Methodological Innovations:

    • Develop new approaches for studying protein bifunctionality in bacterial systems

    • Create improved tools for real-time monitoring of protein activity in infection models

    • Establish robust platforms for structure-based drug design targeting bifunctional proteins

    • Implement advanced genetic tools for precise manipulation of protein function in vivo

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.