Recombinant Yersinia pseudotuberculosis serotype O:3 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; YPK_2063; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGELWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: ypy:YPK_2063

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) and what is its role in Y. pseudotuberculosis?

Cardiolipin synthase (cls) is an enzyme that catalyzes the synthesis of cardiolipin, a dimeric phospholipid that constitutes a significant component of bacterial membranes, particularly at the poles and septa. In Y. pseudotuberculosis, cls (encoded by the cls gene) plays a crucial role in membrane phospholipid composition, which affects membrane fluidity, stability, and function. The enzyme contains catalytic domains similar to phospholipase D (PLD) enzymes, as evidenced by genomic analysis of related species . The protein's full amino acid sequence consists of 486 amino acids with characteristic transmembrane regions that anchor it within the bacterial membrane . Functionally, cardiolipin contributes to the structural integrity of the bacterial cell envelope and may influence various cellular processes including division, protein secretion, and adaptation to environmental stresses.

How does the structure of cls from Y. pseudotuberculosis serotype O:3 differ from other serotypes?

The cls protein from Y. pseudotuberculosis serotype O:3 (strain YPIII) shares high sequence homology with cls from other Y. pseudotuberculosis serotypes, such as serotype O:1b, with only minor amino acid variations. Analysis of the available sequence data shows that cls from serotype O:3 (UniProt ID: B1JKT9) and serotype O:1b (UniProt ID: A7FI50) both consist of 486 amino acids with nearly identical functional domains . The amino acid sequence from serotype O:3 includes transmembrane regions and conserved catalytic motifs characteristic of cardiolipin synthases. The minor differences between serotypes may contribute to subtle variations in enzyme efficiency or substrate specificity, although these functional differences have not been extensively characterized. These slight variations may reflect adaptations to different environmental niches or host interaction strategies employed by the different serotypes.

What enzymatic reaction does cls catalyze and how does it impact bacterial membrane composition?

Cardiolipin synthase catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol. This reaction can be represented as:

2 Phosphatidylglycerol → Cardiolipin + Glycerol

The enzyme contains two PLD-like catalytic domains that are essential for this condensation reaction . In Y. pseudotuberculosis, this enzymatic activity significantly impacts the phospholipid composition of the bacterial membrane, increasing the proportion of cardiolipin, which tends to concentrate at membrane curvatures such as cell poles and division septa. The increased cardiolipin content affects membrane properties including fluidity, permeability, and protein organization. These altered membrane characteristics may influence various cellular processes including cell division, protein secretion systems (particularly the Type III Secretion System important for virulence), and adaptation to environmental stresses such as osmotic shock and pH changes. The cls-mediated modulation of membrane composition may therefore contribute to the pathogen's virulence and survival within host environments.

What expression systems are most effective for producing recombinant Y. pseudotuberculosis cls?

The most effective expression system for producing recombinant Y. pseudotuberculosis cls is E. coli, as demonstrated by successful production of His-tagged full-length cls protein from Y. pseudotuberculosis serotype O:1b . When expressing membrane proteins like cls, selection of appropriate E. coli strains (such as BL21(DE3) or derivatives) optimized for membrane protein expression is crucial. Expression vectors containing inducible promoters (such as T7 or arabinose-inducible promoters) allow controlled protein production. For optimal expression, researchers should consider the following methodological approach:

  • Clone the full-length cls gene (1-486 amino acids) into an expression vector with an appropriate tag (His-tag has proven successful)

  • Transform into an E. coli expression strain

  • Grow cultures at lower temperatures (16-30°C) after induction to prevent inclusion body formation

  • Optimize induction conditions (inducer concentration, induction time, temperature)

  • Use specialized membrane protein purification techniques involving detergents

This approach has yielded recombinant cls with greater than 90% purity as determined by SDS-PAGE analysis .

What purification strategies should be employed for recombinant cls protein?

Purification of recombinant cls protein requires specialized techniques due to its membrane-associated nature. Based on successful production protocols for similar proteins, researchers should implement the following purification strategy:

  • Cell lysis: Use mechanical disruption (sonication or high-pressure homogenization) in buffer containing protease inhibitors

  • Membrane fraction isolation: Separate membrane fractions by ultracentrifugation

  • Solubilization: Extract cls from membranes using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, Triton X-100)

  • Affinity chromatography: For His-tagged cls, use immobilized metal affinity chromatography (IMAC)

  • Further purification: Apply size exclusion chromatography to remove aggregates and obtain homogeneous protein

The purified protein should be maintained in buffer containing stabilizing agents and detergents to prevent aggregation . For long-term storage, add 50% glycerol and store at -20°C or -80°C in small aliquots to avoid repeated freeze-thaw cycles. Purity can be assessed using SDS-PAGE analysis, with successful purifications achieving >90% purity . Protein activity should be verified using in vitro cardiolipin synthase assays measuring the conversion of phosphatidylglycerol to cardiolipin.

How can researchers assess the enzymatic activity of purified recombinant cls?

Assessment of enzymatic activity of purified recombinant cls requires specialized assays that measure the conversion of phosphatidylglycerol to cardiolipin. Researchers can implement the following methodological approaches:

Method 1: Radiolabeled substrate assay

  • Prepare liposomes containing 14C-labeled phosphatidylglycerol

  • Incubate with purified cls in appropriate buffer (typically containing divalent cations like Mg2+)

  • Extract lipids and separate by thin-layer chromatography

  • Quantify radiolabeled cardiolipin formation by phosphorimaging or scintillation counting

Method 2: Fluorescent substrate assay

  • Use fluorescently-labeled phosphatidylglycerol analogs

  • Monitor enzymatic conversion by fluorescence spectroscopy or HPLC

  • Quantify reaction kinetics under varying conditions (pH, temperature, ion concentrations)

Method 3: Mass spectrometry-based assay

  • Incubate purified cls with phosphatidylglycerol substrate

  • Extract lipids after defined reaction periods

  • Analyze by LC-MS/MS to identify and quantify cardiolipin formation

  • Determine enzyme kinetic parameters (Km, Vmax)

Activity assays should include appropriate controls, such as heat-inactivated enzyme, and can be used to characterize optimal reaction conditions, substrate specificity, and inhibition profiles.

How has recombinant Y. pseudotuberculosis been used in vaccine development?

Recombinant Y. pseudotuberculosis strains have been successfully employed as vaccine delivery platforms, particularly for protection against Y. pestis (plague). Several approaches have demonstrated significant promise:

  • Live attenuated Y. pseudotuberculosis vaccines: Engineered strains with genetic modifications (Δ yopK Δ yopJ Δ asd triple mutations) have been used to deliver Y. pestis antigens like YopE-LcrV fusion proteins . These vaccines stimulate both systemic and mucosal immune responses.

  • Outer membrane vesicle (OMV) vaccines: Remodeled Y. pseudotuberculosis PB1+ strains have been designed to produce OMVs containing Y. pestis antigens. These OMVs provide superior protection compared to traditional subunit vaccines .

The advantage of using Y. pseudotuberculosis as a vaccine platform lies in its genetic similarity to Y. pestis while having reduced pathogenicity. Specific achievements include:

  • Y. pseudotuberculosis strain χ10069(pYA5199) delivering YopE-LcrV fusion antigens provided 80% protection against intranasal Y. pestis challenge

  • OMVs from engineered Y. pseudotuberculosis YptbS44(pSMV13) afforded complete protection against both pulmonary and subcutaneous Y. pestis infections

These approaches represent significant advances for plague vaccine development, demonstrating that engineered Y. pseudotuberculosis can serve as an effective vaccine delivery system.

What role does cls play in bacterial membrane vesicle formation and vaccine development?

Cardiolipin synthase (cls) significantly influences bacterial membrane properties and vesicle formation, making it relevant to vaccine development strategies using outer membrane vesicles (OMVs). Cardiolipin, produced by cls, affects membrane curvature and fluidity, potentially influencing OMV biogenesis. Although not explicitly detailed in the search results for Y. pseudotuberculosis cls, research with other bacteria suggests several mechanisms:

  • Cardiolipin accumulation in membrane microdomains can promote negative curvature, facilitating vesicle budding

  • Altered phospholipid composition affects protein localization in the membrane, including virulence factors and immunogens

  • Membrane modifications influence vesicle size, composition, and immunogenicity

In vaccine development contexts, recombinant Y. pseudotuberculosis strains engineered to produce OMVs show particular promise. For example, Y. pseudotuberculosis PB1+ strains designed to produce modified lipid A (MPLA) and express Y. pestis antigens generated OMVs with enhanced immunogenic properties . These OMVs provided superior protection against Y. pestis challenge compared to traditional subunit vaccines. The engineering of membrane composition, potentially including cls-mediated cardiolipin synthesis, represents an avenue for optimizing OMV-based vaccine platforms.

How does the Type III Secretion System (T3SS) interact with cls in Y. pseudotuberculosis?

The Type III Secretion System (T3SS) is a critical virulence mechanism in Y. pseudotuberculosis that forms a needle-like structure to inject effector proteins into host cells. While direct interactions between T3SS and cls haven't been explicitly characterized in the search results, several interconnections can be inferred based on membrane biology principles:

  • Membrane localization: Both T3SS components and cls are membrane-associated proteins. Cardiolipin-rich membrane domains may influence the assembly and function of the T3SS apparatus.

  • Secretion dynamics: Research has shown that recombinant proteins like YopE-LcrV fusion can be secreted via T3SS in calcium-depleted conditions, demonstrating that the T3SS is functional in recombinant Y. pseudotuberculosis strains .

  • Potential functional relationship: Cardiolipin's role in membrane organization might affect T3SS assembly and function. The membrane composition modulated by cls could influence:

    • T3SS complex stability

    • Efficiency of effector protein secretion

    • Energy coupling for the secretion process

Experimental evidence shows that in engineered Y. pseudotuberculosis strains, the T3SS-mediated secretion of proteins occurs only under specific conditions (calcium deprivation at 37°C), while protein synthesis is constitutive . This suggests complex regulatory mechanisms influencing T3SS function that may indirectly involve membrane composition maintained by enzymes like cls.

How can researchers use site-directed mutagenesis to study cls function in Y. pseudotuberculosis?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships of cls in Y. pseudotuberculosis. Based on the amino acid sequence information provided for the cls protein , researchers can implement the following methodological strategy:

  • Target critical residues for mutagenesis:

    • Catalytic site residues in the two PLD-like domains

    • Conserved motifs identified through sequence alignment with other cardiolipin synthases

    • Transmembrane regions that may influence membrane association

  • Mutagenesis techniques:

    • PCR-based site-directed mutagenesis

    • Gibson assembly or overlap extension PCR for multiple mutations

    • CRISPR-Cas9 genome editing for chromosomal mutations

  • Functional analysis of mutants:

    • Enzymatic activity assays comparing wild-type and mutant proteins

    • Membrane localization studies using fluorescent protein fusions

    • Bacterial physiology assessments (growth, stress response, membrane integrity)

  • Specific mutations to consider:

    • HKD motif mutations (typically H and K residues in the catalytic domains)

    • Transmembrane region alterations affecting membrane integration

    • Substrate binding site modifications to alter specificity

This approach would provide insights into which amino acid residues are critical for cls function, membrane association, and substrate recognition, enhancing our understanding of cardiolipin synthesis mechanisms in Y. pseudotuberculosis.

What comparative approaches can reveal differences in cls function between Y. pseudotuberculosis and Y. pestis?

Y. pseudotuberculosis and Y. pestis are closely related pathogens with different infection strategies and host tropisms. Comparative analysis of cls function between these species can reveal adaptations related to their distinct lifestyles. Researchers can implement several methodological approaches:

  • Sequence and structural comparisons:

    • Align cls sequences from Y. pseudotuberculosis serotype O:3 and Y. pestis

    • Identify amino acid differences that might affect enzyme activity

    • Use homology modeling to predict structural differences

  • Complementation studies:

    • Create cls deletion mutants in both species

    • Perform cross-complementation with cls from the other species

    • Evaluate restoration of phenotypes related to membrane function

  • Cardiolipin profiling:

    • Compare cardiolipin content and distribution in membranes of both species

    • Analyze cardiolipin fatty acid composition differences

    • Investigate cardiolipin dynamics under various environmental conditions

  • Functional impact assessment:

    • Compare roles in T3SS function between species

    • Evaluate contribution to stress resistance

    • Analyze impact on host-pathogen interactions

A comparative analysis could use techniques such as lipidomics, fluorescence microscopy with cardiolipin-specific dyes, and bacterial genetics to elucidate how cls function may have evolved during Y. pestis emergence from Y. pseudotuberculosis and contribute to their different pathogenic strategies.

How can cls be targeted for antimicrobial development against Yersinia species?

The essential role of cardiolipin in bacterial membrane function makes cls a potential target for novel antimicrobial development against Yersinia species. Researchers can pursue several strategic approaches:

  • Target-based inhibitor design:

    • Use the structural information and sequence data of cls to create homology models

    • Perform virtual screening for compounds that may bind catalytic domains

    • Develop high-throughput assays to screen chemical libraries for cls inhibitors

  • Phenotypic screening:

    • Screen for compounds that disrupt cardiolipin synthesis or distribution

    • Identify molecules that specifically affect Yersinia membrane integrity

    • Look for synergistic effects with existing antibiotics

  • Evaluation methodology:

    • Assess inhibitor specificity against bacterial vs. mammalian cardiolipin synthases

    • Determine effects on bacterial growth, membrane integrity, and virulence

    • Test efficacy in infection models

  • Combination approaches:

    • Target cls in conjunction with other membrane-associated processes

    • Investigate synergy with antibiotics targeting cell wall synthesis

    • Explore potential for sensitizing bacteria to host defense mechanisms

Potential challenges include identifying inhibitors with sufficient selectivity for bacterial cls over mammalian cardiolipin synthases and ensuring adequate penetration of compounds through the bacterial envelope. Nevertheless, cls represents a promising target for novel antimicrobial strategies against Yersinia species, particularly given its importance in membrane homeostasis and potential roles in virulence.

What are common challenges in purifying active recombinant cls and how can they be addressed?

Purifying active recombinant cls presents several challenges due to its nature as a membrane-associated enzyme. Researchers frequently encounter the following issues and can implement these solutions:

ChallengeCauseSolution
Low expression levelsToxicity to host cells, poor codon usageUse tightly controlled inducible promoters, codon-optimized gene, expression at low temperatures (16-25°C)
Inclusion body formationProtein misfolding, overexpressionReduce induction levels, use solubility-enhancing tags (MBP, SUMO), express at lower temperatures
Poor solubilizationInsufficient detergent extractionScreen multiple detergents (DDM, LDAO, Triton X-100), optimize detergent:protein ratios
Loss of activity during purificationDetergent effects, cofactor lossInclude stabilizing lipids and cofactors in buffers, use milder detergents
Protein aggregationDetergent removal, concentration issuesAdd glycerol (6-50%) to storage buffer , maintain minimum effective detergent concentration

For successful purification, researchers should consider using the buffer systems described for cls storage (Tris-based buffer with 50% glycerol) or Tris/PBS-based buffer with 6% trehalose . Additionally, avoiding repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week can help maintain enzyme activity . Enzyme activity should be assessed immediately after purification to establish a baseline for stability studies.

How can researchers overcome difficulties in assessing cls activity in membrane systems?

Assessing cls activity in membrane systems presents unique challenges due to the complexity of lipid bilayers and the membrane-associated nature of the enzyme. Researchers can implement several methodological approaches to overcome these difficulties:

  • Reconstitution systems:

    • Incorporate purified cls into liposomes containing phosphatidylglycerol

    • Use nanodiscs or bicelles as membrane mimetics for controlled enzyme environment

    • Adjust lipid composition to mimic native bacterial membranes

  • Activity detection methods:

    • Implement fluorescence-based assays using labeled phosphatidylglycerol

    • Develop coupled enzyme assays that detect glycerol release

    • Use mass spectrometry to directly measure cardiolipin formation

  • Controls and validations:

    • Include detergent-solubilized enzyme activity measurements as comparison

    • Use known cls inhibitors to confirm specificity of activity

    • Verify cardiolipin product by multiple analytical methods

  • Experimental conditions optimization:

    • Screen buffer compositions, pH ranges, and ion concentrations

    • Test temperature dependence of activity

    • Evaluate effects of membrane curvature and lateral pressure

By combining these approaches, researchers can develop robust assays for cls activity that overcome the inherent challenges of working with membrane-embedded enzymes and provide valuable insights into cardiolipin synthesis mechanisms under physiologically relevant conditions.

What analytical methods are most effective for studying cardiolipin production in Y. pseudotuberculosis?

Effective analysis of cardiolipin production in Y. pseudotuberculosis requires sophisticated analytical techniques that can identify and quantify this phospholipid in complex biological samples. The following methodological approaches are recommended:

  • Thin-layer chromatography (TLC):

    • Extract total lipids using Bligh-Dyer or Folch methods

    • Separate phospholipids on silica plates using chloroform/methanol/water systems

    • Visualize with phospholipid-specific stains (molybdenum blue, primuline)

    • Quantify by densitometry with cardiolipin standards

  • Mass spectrometry-based approaches:

    • LC-MS/MS analysis of extracted lipids for specific cardiolipin species identification

    • Shotgun lipidomics for comprehensive profiling of all phospholipids

    • Multiple reaction monitoring (MRM) for targeted quantification of cardiolipin species

    • Analysis of cardiolipin fatty acid composition by GC-MS after hydrolysis

  • Fluorescence microscopy:

    • Stain cells with cardiolipin-specific dyes (NAO, 10-N-nonyl acridine orange)

    • Visualize subcellular localization of cardiolipin

    • Quantify fluorescence intensity to estimate relative cardiolipin content

    • Combine with super-resolution microscopy for detailed distribution analysis

  • Functional assays:

    • Monitor membrane potential using voltage-sensitive dyes

    • Assess membrane permeability changes associated with cardiolipin alterations

    • Evaluate osmotic stress resistance as a functional readout of membrane composition

These complementary approaches provide comprehensive insights into cardiolipin production, localization, and function in Y. pseudotuberculosis, enabling researchers to connect biochemical activities of cls with cellular physiology and pathogenesis.

What are the most significant recent advances in understanding cls function in Yersinia species?

Recent research has significantly advanced our understanding of cardiolipin synthase function in Yersinia species, particularly in the context of membrane biology and pathogenesis. Several key advances stand out:

  • The characterization of cls genes and proteins from different Yersinia species and serotypes has revealed high conservation of enzyme structure and function, suggesting evolutionary importance . This conservation extends to the presence of two PLD-like catalytic domains that are essential for cardiolipin synthesis .

  • The development of recombinant expression systems for producing active cls protein has enabled detailed biochemical characterization and potential applications in structural biology studies . These systems provide the foundation for mechanistic studies of enzyme function.

  • Recognition of the potential connection between membrane composition (influenced by cls) and virulence mechanisms, particularly the assembly and function of secretion systems like T3SS . This connection provides insight into how basic membrane biology influences pathogenesis.

  • Advances in engineering Yersinia pseudotuberculosis for vaccine development, including the production of outer membrane vesicles with immunogenic properties, which may be influenced by membrane composition maintained in part by cls activity . These approaches have demonstrated superior protection compared to traditional subunit vaccines.

These advances collectively point to the importance of cardiolipin and cls in Yersinia biology and highlight potential applications in vaccine development and antimicrobial strategies.

What are the most promising future research directions for Y. pseudotuberculosis cls studies?

Future research on Y. pseudotuberculosis cls holds significant promise in several key directions:

  • Structural biology: Determining the three-dimensional structure of cls would provide critical insights into its catalytic mechanism and facilitate structure-based drug design. Techniques such as cryo-electron microscopy, which excels with membrane proteins, could be particularly valuable.

  • Systems biology approaches: Integration of lipidomics, proteomics, and transcriptomics to understand how cls function and cardiolipin synthesis are regulated in response to environmental conditions and during infection.

  • Host-pathogen interactions: Investigating how cardiolipin and cls activity influence Y. pseudotuberculosis interactions with host cells, particularly regarding membrane dynamics during attachment, invasion, and intracellular survival.

  • Vaccine development: Further optimization of OMV-based vaccines by modulating membrane composition through cls engineering, potentially enhancing immunogenicity and protective efficacy .

  • Antimicrobial development: Exploration of cls as a potential target for novel antimicrobials, focusing on the unique aspects of bacterial cardiolipin synthesis that differentiate it from mammalian systems.

  • Evolutionary adaptations: Comparative analysis of cls function across Yersinia species to understand how cardiolipin metabolism may have contributed to the evolution of different pathogenic strategies.

These research directions hold promise for both fundamental understanding of bacterial physiology and practical applications in infectious disease control and prevention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.