Recombinant Yersinia pseudotuberculosis serotype O:3 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Yersinia pseudotuberculosis serotype O:3 Fumarate Reductase Subunit C (FrdC)

Recombinant Yersinia pseudotuberculosis serotype O:3 Fumarate Reductase Subunit C (FrdC) refers to a specific protein produced using recombinant DNA technology . FrdC is a subunit of the fumarate reductase enzyme found in Yersinia pseudotuberculosis serotype O:3 .

  • Fumarate Reductase: Fumarate reductase is an enzyme that catalyzes the reduction of fumarate to succinate, typically as part of anaerobic respiration .

  • Yersinia pseudotuberculosis: This bacterium is a Gram-negative organism that causes yersiniosis, an infection characterized by symptoms such as fever, abdominal pain, and diarrhea . Serotype O:3 is a particular serological variant of this species .

  • Recombinant Production: The FrdC subunit is produced in a host organism (e.g., E. coli) using genetic engineering techniques. The gene encoding FrdC is inserted into a plasmid, which is then introduced into the host organism, causing it to produce the FrdC protein . The recombinant protein often includes a tag, such as a histidine (His) tag, to facilitate purification .

Characteristics

CharacteristicDescription
SpeciesYersinia pseudotuberculosis serotype O:3
Source OrganismE. coli
TagHis-tagged (N-terminal)
Protein LengthFull Length (1-130 amino acids)
FormLyophilized powder

Function and Significance

  1. In vitro Studies: Recombinant FrdC is primarily used in laboratory research for various applications :

    • ELISA assays: As an antigen in Enzyme-Linked Immunosorbent Assays .

    • Biochemical studies: To study the enzymatic activity and properties of fumarate reductase.

    • Structural studies: To determine the three-dimensional structure of the protein.

  2. Diagnostic Tool Development: Proteins like FrdC can be instrumental in developing diagnostic tools. For example, the tail fiber protein of phage φYeO3-12, which specifically recognizes Yersinia serotype O:3, has been identified as a promising tool for pathogen recognition .

  3. Virulence Factors: In Yersinia, virulence factors like YadA (Yersinia adhesion A) are crucial for the bacteria's pathogenicity. YadA mediates adhesion to host cells, resistance to phagocytosis, and serum resistance . Though FrdC is not directly a virulence factor, understanding its role in bacterial metabolism can provide insights into bacterial survival and pathogenesis.

Role in Yersinia pseudotuberculosis Pathogenesis

Yersinia pseudotuberculosis employs various mechanisms to establish infection, including adhesion, invasion, and immune evasion .

Research Findings

  1. Outbreak Investigations: Y. pseudotuberculosis O:3 infections have been linked to contaminated food sources, such as iceberg lettuce. A case-control study identified iceberg lettuce consumption as a significant risk factor during an outbreak, with isolates showing indistinguishable PFGE patterns .

  2. Diagnostic Applications: The O-specific polysaccharide (O-antigen) of Yersinia strains is used for serological characterization. The tail fiber protein Gp17 of phage φYeO3-12 specifically recognizes pathogenic Yersinia serotype O:3, showing promise as a diagnostic tool .

  3. Virulence Mechanisms: Studies on YopJ have revealed its role in attenuating host responses by inactivating MAPK signaling pathways and suppressing PGE2 biosynthesis .

  4. Environmental Factors: Temperature influences the expression of virulence factors. For example, YadA expression is induced at 37°C, and O-antigen expression can vary with temperature, affecting invasin accessibility .

Potential Applications

  1. Diagnostics: Recombinant FrdC can be used to develop diagnostic assays for detecting Y. pseudotuberculosis O:3 infections, especially in food safety and clinical settings .

  2. Vaccine Development: While not explicitly documented for FrdC, recombinant proteins are often explored as vaccine candidates. Further research could investigate FrdC's potential in eliciting protective immunity.

  3. Drug Discovery: Understanding the structure and function of FrdC can aid in the development of targeted therapeutics that disrupt bacterial metabolism.

Limitations and Future Directions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; YPK_3815; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
frdC
Target Protein Sequence
MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGF VSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVA SAIILAVALL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: ypy:YPK_3815

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does frdC fit into the taxonomic and genomic context of Yersinia pseudotuberculosis?

Yersinia pseudotuberculosis is a Gram-negative bacterium belonging to the Yersiniaceae family within the order Enterobacterales . The frdC gene (designated as YPK_3815 in some databases) encodes one of the essential components of the fumarate reductase enzyme complex .

Within the genomic context, frdC is part of the frd operon, which typically includes genes encoding all subunits of the fumarate reductase complex. This arrangement ensures coordinated expression of all components necessary for functional enzyme assembly. Y. pseudotuberculosis, like other facultative anaerobes, maintains this genomic organization to support metabolic flexibility under various environmental conditions.

What are the optimal conditions for expressing recombinant frdC in E. coli systems?

For successful expression of recombinant Y. pseudotuberculosis frdC in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Choose expression vectors containing strong inducible promoters (T7, tac) and incorporating an N-terminal His-tag for purification.

  • Host strain optimization: BL21(DE3) or derivatives are recommended due to their reduced protease activity and compatibility with membrane protein expression.

  • Growth conditions:

    • Initial culture: Grow at 37°C until early-log phase (OD600 0.4-0.6)

    • Induction: Reduce temperature to 16-20°C before induction to minimize inclusion body formation

    • Inducer concentration: 0.1-0.5 mM IPTG (lower concentrations favor proper folding)

    • Post-induction: Continue expression for 16-18 hours at reduced temperature

  • Media supplementation: Consider adding specific phospholipids or membrane-supporting compounds when expressing hydrophobic proteins like frdC .

Following expression, membrane fractionation should be performed to isolate the membrane-associated recombinant protein prior to solubilization with appropriate detergents.

What are the challenges and solutions for maintaining structural integrity during purification of frdC?

Purifying membrane proteins like frdC presents several challenges due to their hydrophobic nature. Research has demonstrated the following effective methodological approaches:

  • Membrane solubilization:

    • Use mild detergents (DDM, LDAO, or C12E8) at concentrations just above their CMC

    • Maintain buffer pH between 7.0-8.0 with 150-300 mM NaCl to stabilize the protein

  • Chromatography strategies:

    • Initial purification: IMAC (Immobilized Metal Affinity Chromatography) utilizing the His-tag

    • Secondary purification: Size exclusion chromatography to separate protein-detergent complexes

  • Storage considerations:

    • Short-term: Store at 4°C (up to one week) to prevent degradation

    • Long-term: Store at -20°C/-80°C with 50% glycerol as a cryoprotectant

    • Avoid repeated freeze-thaw cycles which destabilize membrane proteins

  • Reconstitution protocol:

    • Prior to use, briefly centrifuge the protein vial

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for long-term storage

Monitoring protein quality throughout purification via SDS-PAGE and western blotting is essential to confirm integrity of the target protein.

How can researchers accurately measure the enzymatic activity of purified frdC in isolation and as part of the fumarate reductase complex?

While frdC alone does not possess catalytic activity, its role within the fumarate reductase complex is crucial for enzymatic function. To assess functional activity:

  • Reconstitution of the complete complex:

    • Express and purify all subunits (frdA, frdB, frdC, frdD)

    • Reconstitute in phospholipid vesicles or nanodiscs to mimic membrane environment

    • Verify complex assembly through BN-PAGE (Blue Native PAGE)

  • Spectrophotometric activity assays:

    • Forward reaction (fumarate reduction): Monitor decrease in absorbance at 340 nm as NADH is oxidized via an electron transport system to frdABCD

    • Reverse reaction (succinate oxidation): Couple to reduction of artificial electron acceptors (DCPIP, ferricyanide) and monitor absorbance changes

  • Membrane potential measurements:

    • Reconstitute complex in liposomes containing potential-sensitive fluorescent dyes

    • Measure fluorescence changes upon substrate addition

Based on studies of homologous proteins in Campylobacter jejuni, it's important to note that fumarate reductase may exhibit dual functionality as both fumarate reductase and succinate dehydrogenase . Therefore, bidirectional activity assays are recommended for complete functional characterization.

What is the role of frdC in the electron transport chain of Y. pseudotuberculosis during anaerobic respiration?

In Y. pseudotuberculosis, frdC functions as a membrane anchor subunit of the fumarate reductase complex, which plays a critical role in anaerobic respiration by catalyzing the terminal step of the electron transport chain. The specific functions include:

  • Membrane integration: The hydrophobic composition of frdC anchors the fumarate reductase complex within the bacterial membrane.

  • Quinol binding site formation: frdC contains amino acid residues that form the quinol binding pocket, facilitating electron transfer from the membrane quinol pool to the catalytic site.

  • Proton management: The transmembrane orientation of frdC may contribute to proton translocation mechanisms associated with the redox reactions of the complex.

Studies on analogous fumarate reductase systems suggest that frdC is essential for both the assembly and function of the complex . In C. jejuni, the homologous fumarate reductase was found to be the sole succinate dehydrogenase, suggesting similar dual functionality might exist in Y. pseudotuberculosis . This dual role would allow the bacterium to adapt its respiration mechanism according to environmental conditions and available electron acceptors.

How does frdC contribute to the metabolic flexibility and pathogenesis of Y. pseudotuberculosis?

Fumarate reductase, including its frdC subunit, contributes significantly to the metabolic flexibility that enhances Y. pseudotuberculosis virulence:

  • Anaerobic adaptation: Y. pseudotuberculosis causes tuberculosis-like symptoms in animals with localized tissue necrosis and granulomas . These infection sites often become oxygen-limited, requiring anaerobic respiration pathways for bacterial survival.

  • Metabolic plasticity: By utilizing fumarate as a terminal electron acceptor, Y. pseudotuberculosis can maintain redox balance and ATP production in oxygen-restricted environments encountered during infection.

  • Niche colonization: Similar to observations in C. jejuni where fumarate reductase mutants showed impaired colonization in animal models , the fumarate reductase in Y. pseudotuberculosis likely supports persistence within specific host microenvironments.

The bacterium's ability to shift between aerobic and anaerobic metabolism contributes to its success as a pathogen causing Far East scarlet-like fever in humans, typically through zoonotic food-borne transmission . Targeting this metabolic flexibility represents a potential therapeutic strategy against Y. pseudotuberculosis infections.

What experimental approaches can be used to investigate the role of frdC in Y. pseudotuberculosis virulence?

To investigate frdC's role in virulence, researchers can employ the following experimental strategies:

  • Genetic manipulation approaches:

    • Create targeted knockout strains (ΔfrdC) using homologous recombination

    • Construct conditional expression mutants to control frdC expression levels

    • Develop complementation strains to verify phenotypic restoration

  • In vitro virulence assays:

    • Survival under anaerobic conditions or in microaerophilic environments

    • Growth kinetics in media with different carbon sources

    • Resistance to oxidative and nitrosative stress

    • Biofilm formation capacity

  • Cell culture infection models:

    • Invasion and persistence in epithelial cell lines

    • Intracellular survival in macrophages

    • Analysis of host cell responses (cytokine production, cell death pathways)

  • In vivo infection studies:

    • Animal colonization models (similar to C. jejuni studies where frdA mutants showed reduced chicken colonization )

    • Tissue distribution and bacterial burden quantification

    • Histopathological examination of infected tissues

    • Competitive index assays comparing wild-type and mutant strains

  • Transcriptional profiling:

    • RNA-seq under different oxygen conditions

    • ChIP-seq to identify regulators of frdC expression

    • Analysis of metabolic pathway shifts in response to environmental changes

These approaches would provide comprehensive insights into how frdC contributes to Y. pseudotuberculosis pathogenesis and identify potential targets for antimicrobial development.

How does the structure and function of Y. pseudotuberculosis frdC compare with homologous proteins in other bacterial species?

Comparative analysis of Y. pseudotuberculosis frdC with homologous proteins reveals important evolutionary and functional relationships:

SpeciesProteinSequence SimilarityFunctional RoleNotable Differences
Y. pseudotuberculosisfrdCReferenceMembrane anchor in fumarate reductase130 amino acids, hydrophobic composition
C. jejuniFrdCModeratePart of dual-functioning fumarate reductase/succinate dehydrogenaseEssential for both fumarate reduction and succinate oxidation
E. coliFrdCHighMembrane anchor in fumarate reductaseSimilar role but differences in regulatory control
Wolinella succinogenesFrdCModerateMembrane anchor in fumarate reductasePart of a highly efficient hydrogen-fumarate system

Research on C. jejuni has demonstrated that its fumarate reductase functions as the sole succinate dehydrogenase, contradicting previous annotations . This functional duality may be conserved in Y. pseudotuberculosis, suggesting an evolutionary adaptation that provides metabolic flexibility. The membrane-anchoring function of frdC is highly conserved across diverse bacterial species, highlighting its essential role in complex assembly and electron transport chain integration.

What advanced molecular modeling techniques can be applied to predict frdC interactions within the fumarate reductase complex?

To predict and analyze frdC interactions within the fumarate reductase complex, researchers can employ the following advanced molecular modeling techniques:

  • Homology modeling:

    • Utilize crystal structures of homologous fumarate reductase complexes as templates

    • Generate refined structural models specific to Y. pseudotuberculosis frdC

    • Validate models using energy minimization and Ramachandran plot analysis

  • Molecular dynamics simulations:

    • Embed the protein complex in a virtual phospholipid bilayer

    • Simulate dynamic interactions in nanosecond to microsecond timescales

    • Analyze conformational changes under different substrate binding states

  • Protein-protein docking:

    • Predict interaction interfaces between frdC and other subunits (frdA, frdB, frdD)

    • Identify key residues involved in complex stability

    • Calculate binding energies to quantify interaction strengths

  • Quantum mechanical/molecular mechanical (QM/MM) approaches:

    • Model electron transfer pathways from quinol through the complex

    • Calculate energy barriers for catalytic reactions

    • Predict effects of mutations on electron transfer efficiency

  • Systems biology integration:

    • Connect structural predictions with metabolic flux models

    • Simulate the impact of environmental changes on complex activity

    • Predict system-level effects of targeting fumarate reductase

These computational approaches provide valuable insights that can guide experimental design and interpretation, particularly for membrane proteins like frdC where structural determination through traditional methods remains challenging.

How can recombinant frdC be utilized in the development of novel antimicrobial strategies against Y. pseudotuberculosis?

Recombinant frdC offers several avenues for antimicrobial development against Y. pseudotuberculosis:

  • Structural vaccinology approaches:

    • Identifying exposed epitopes of frdC for potential inclusion in subunit vaccines

    • Utilizing recombinant frdC in combination with appropriate adjuvants

    • Engineering outer membrane vesicles (OMVs) expressing frdC epitopes, similar to approaches used with other Y. pseudotuberculosis antigens

  • High-throughput inhibitor screening:

    • Developing assays using purified recombinant frdC within reconstituted complexes

    • Screening chemical libraries for compounds that disrupt complex assembly

    • Identifying molecules that block quinol binding sites within frdC

  • Peptide-based inhibitors:

    • Designing competitive peptides that mimic frdC interaction domains

    • Developing cell-penetrating antimicrobial peptides targeting the fumarate reductase complex

    • Creating peptide-drug conjugates for targeted delivery to bacterial membranes

  • Immunotherapeutic strategies:

    • Developing monoclonal antibodies against surface-exposed regions of frdC

    • Creating antibody-antibiotic conjugates for targeted delivery

    • Enhancing immune recognition of Y. pseudotuberculosis through frdC-specific responses

These approaches target the metabolic flexibility that allows Y. pseudotuberculosis to thrive in oxygen-limited environments during infection, potentially reducing its ability to cause diseases like Far East scarlet-like fever in humans .

What technical challenges must be overcome when using recombinant frdC for antibody production and immunological studies?

Researchers face several challenges when using recombinant frdC for immunological applications:

  • Protein solubility and native conformation:

    • Challenge: Maintaining native membrane protein conformation in solution

    • Solution: Use of amphipathic molecules (detergents, amphipols) or nanodiscs to stabilize hydrophobic regions

    • Methodology: Optimize detergent:protein ratios through systematic screening

  • Epitope accessibility:

    • Challenge: Many potential epitopes may be embedded in the membrane in vivo

    • Solution: Design peptide antigens corresponding to predicted surface-exposed regions

    • Methodology: Use computational predictions combined with experimental validation

  • Cross-reactivity concerns:

    • Challenge: Potential antibody cross-reactivity with host proteins or other bacterial species

    • Solution: Careful selection of unique regions for immunization

    • Methodology: Extensive antibody validation using multiple bacterial species and host tissues

  • Adjuvant selection:

    • Challenge: Standard adjuvants may cause protein denaturation

    • Solution: Test multiple adjuvant formulations compatible with membrane proteins

    • Methodology: Compare antibody titers and specificity across different adjuvant systems

  • Verification of antibody functionality:

    • Challenge: Confirming antibodies recognize native protein in bacterial context

    • Solution: Use multiple detection methods (Western blot, immunofluorescence, flow cytometry)

    • Methodology: Include appropriate positive and negative controls in all validation experiments

By addressing these challenges, researchers can develop reliable immunological tools for studying frdC expression, localization, and function in Y. pseudotuberculosis, supporting both basic research and applied antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.