Recombinant Yersinia pseudotuberculosis serotype O:3 NADH-quinone oxidoreductase subunit A (nuoA)

What is Yersinia pseudotuberculosis serotype O:3 and why is it significant for research?

Yersinia pseudotuberculosis serotype O:3 is one of the most clinically relevant serotypes within the Y. pseudotuberculosis complex. It is a gram-negative, facultatively anaerobic, non-spore-forming coccoid bacillus belonging to the Enterobacteriaceae family . The O:3 serotype has been implicated in several outbreaks, including a significant outbreak in Finland where it was transmitted through contaminated iceberg lettuce . Its genome has been fully sequenced (strain YPIII), making it valuable for comparative genomic studies and molecular research .

The O-antigen serotyping scheme for Y. pseudotuberculosis involves 21 different serotypes, with the O:3 serotype specifically determined by the unique structure of its O-antigen polysaccharide . This serotype is important in research due to its pathogenicity and distinctive genetic features compared to other Yersinia species and serotypes.

What is the structure and function of NADH-quinone oxidoreductase subunit A (nuoA) in Y. pseudotuberculosis?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of respiratory complex I (NADH dehydrogenase), a multisubunit enzyme involved in the electron transport chain. In Y. pseudotuberculosis, nuoA is characterized by the following features:

• Structural Characteristics: The protein consists of 166 amino acids with a molecular weight of approximately 31 kDa .

• Amino Acid Sequence: The full sequence is MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFIGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR .

• Function: nuoA participates in the oxidation of NADH to NAD+, transferring electrons to quinones in the respiratory chain and contributing to the generation of a proton gradient for ATP synthesis.

• EC Number: 1.6.99.5 .

The protein is functionally similar to but structurally distinct from the Na(+)-translocating NADH-quinone reductase subunits (nqr proteins) also found in Y. pseudotuberculosis .

What are the optimal conditions for recombinant expression of Y. pseudotuberculosis nuoA?

For optimal recombinant expression of Y. pseudotuberculosis nuoA, researchers should consider the following methodological approach:

Expression System Selection:

• E. coli expression systems are most commonly used for nuoA expression due to their simplicity and high yield.

• Mammalian cell expression systems may be preferred when post-translational modifications are critical .

Expression Protocol:

• Vector Selection: Choose vectors with strong promoters such as T7 or tac.

• Temperature: Optimal expression is typically achieved at 28°C rather than 37°C to reduce inclusion body formation .

• Induction: Use 0.5mM IPTG when OD600 reaches 0.4-0.6.

• Growth Media: LB medium supplemented with appropriate antibiotics based on the resistance marker.

• Expression Time: 16-18 hours post-induction for maximal yield.

Common Challenges and Solutions:

• Inclusion Body Formation: Lower the expression temperature to 18-20°C and reduce inducer concentration.

• Protein Solubility: Consider fusion tags (His, MBP, GST) to enhance solubility.

• Membrane Association: Use appropriate detergents (e.g., 0.5% CHAPS or 1% Triton X-100) during extraction.

What purification strategies yield the highest purity and activity for recombinant nuoA?

A multi-step purification approach is recommended for obtaining high-purity, functionally active nuoA:

Purification Protocol:

• Initial Extraction:

  • Cell lysis using 0.5M EDTA on ice for 1 hour followed by centrifugation at 10,000 × g for 15 minutes at 4°C .

  • Filtration through a 0.22-μm filter to remove cellular debris.

• Affinity Chromatography:

  • For His-tagged constructs, use Ni-NTA resin with imidazole gradient elution (20-250 mM).

  • Wash extensively to remove non-specific binding proteins.

• Size Exclusion Chromatography:

  • Apply concentrated protein to a Superdex 75/200 column to separate monomeric protein from aggregates.

• Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week.

Purity Assessment:

• 90% purity as determined by SDS-PAGE is generally acceptable for most research applications .

How can researchers assess the enzymatic activity of purified recombinant nuoA?

Enzymatic activity of purified recombinant nuoA can be assessed through several complementary approaches:

NADH Oxidation Assay:

• Prepare reaction buffer containing 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, and 0.1 mM EDTA.

• Add 0.2 mM NADH and appropriate concentration of quinone substrate (typically ubiquinone-1 or coenzyme Q1).

• Initiate reaction by adding purified nuoA (1-5 μg/ml).

• Monitor decrease in absorbance at 340 nm (NADH oxidation) over time.

• Calculate activity using extinction coefficient of NADH (6,220 M⁻¹cm⁻¹).

Electron Transfer Assay:

• Use artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP).

• Monitor reduction of electron acceptors spectrophotometrically.

Reconstitution Studies:

• For comprehensive functional characterization, reconstitute nuoA with other complex I subunits to assess its role in the complete enzyme complex.

Inhibitor Sensitivity:

• Test sensitivity to known complex I inhibitors such as rotenone or pyridaben to confirm specific activity .

What role does nuoA play in bacterial energy metabolism and pathogenesis?

The nuoA subunit plays critical roles in both energy metabolism and potentially in pathogenesis:

Energy Metabolism:

• As part of NADH-quinone oxidoreductase (complex I), nuoA contributes to respiratory electron transport and energy conservation.

• It helps establish the proton motive force necessary for ATP synthesis.

• The complex is particularly important under aerobic and microaerobic growth conditions.

Pathogenesis Relevance:

• Respiratory flexibility provided by nuoA and related proteins may contribute to Y. pseudotuberculosis adaptation in different host environments.

• While direct evidence for nuoA's role in virulence is limited, disruption of bacterial energy metabolism generally impacts pathogen survival in host environments.

• Studies with related bacteria suggest that respiratory chain components may influence host immune response and bacterial persistence .

Comparative Analysis:
Single-subunit NADH dehydrogenases from other organisms have been shown to render resistance to complex I inhibitors and support electron transport chain function , suggesting potential roles for nuoA in stress response and adaptation.

How can recombinant nuoA be utilized in vaccine development strategies?

Recombinant nuoA can be explored for vaccine development through several research approaches:

As an Antigenic Component:

• nuoA can potentially serve as a novel target for subunit vaccines against Y. pseudotuberculosis.

• Its conservation across strains makes it a candidate for broad-spectrum protection.

Integration with Delivery Systems:

• Outer membrane vesicles (OMVs) from Y. pseudotuberculosis can be engineered to incorporate recombinant nuoA, potentially enhancing immunogenicity .

• This approach has shown promise with other Y. pseudotuberculosis proteins, as demonstrated with ΔlpxL rOMV systems .

Attenuated Strain Development:

• Modifications of nuoA expression could be explored in the context of attenuated Y. pseudotuberculosis strains for live vaccine development.

• The approach used for other Yersinia proteins, such as incorporating heterologous antigens into attenuated Y. pseudotuberculosis strains (e.g., the χ10068 strain), provides a model for such strategies .

Immune Response Analysis:

• Research shows that Y. pseudotuberculosis OMVs containing recombinant proteins can elicit balanced Th1/Th2 immune responses with elevated IgM and IgA antibodies , suggesting nuoA-containing constructs could be similarly effective.

What experimental models are appropriate for studying recombinant nuoA in the context of host-pathogen interactions?

Several experimental models can be employed to study recombinant nuoA in host-pathogen interactions:

In vitro Models:

• Macrophage Infection Models: Assess the impact of nuoA expression on Y. pseudotuberculosis survival in human or murine macrophage cell lines (e.g., THP-1, RAW264.7).

• Epithelial Cell Adhesion/Invasion Assays: Determine whether nuoA affects bacterial adherence to and invasion of intestinal epithelial cells (e.g., Caco-2, HT-29).

• Immune Cell Stimulation: Evaluate cytokine responses in dendritic cells or neutrophils exposed to nuoA-expressing bacteria or purified recombinant nuoA.

In vivo Models:

• Mouse Infection Models: Oral administration of Y. pseudotuberculosis with modified nuoA expression to assess colonization and dissemination.

• Immunization-Challenge Studies: Immunize mice with recombinant nuoA (alone or in combination with other antigens) followed by challenge with virulent Y. pseudotuberculosis.

Key Readouts for Analysis:

• Bacterial burden in tissues (spleen, liver, mesenteric lymph nodes)

• Histopathological changes, particularly in liver and lymphoid tissues

• Antibody responses (IgG, IgA, IgM titers)

• T-cell responses (IFN-γ, IL-4, IL-17 production)

• Survival rates following challenge

How does nuoA from Y. pseudotuberculosis serotype O:3 compare with homologs from other serotypes or related Yersinia species?

Comparative analysis of nuoA across Yersinia species and serotypes reveals important evolutionary and functional insights:

Sequence Conservation:
The table below summarizes key comparisons between nuoA from Y. pseudotuberculosis O:3 and homologs from related species:

Functional Implications:

• Despite high sequence conservation, subtle amino acid differences may influence substrate specificity or electron transfer efficiency.

• The higher conservation between Y. pseudotuberculosis O:3 and Y. pestis suggests similar functional properties, consistent with their close evolutionary relationship.

Genomic Context:

• The nuoA gene is part of the nuo operon, which is conserved across Yersinia species.

• While the gene order is preserved, regulatory elements may differ, potentially leading to differential expression patterns.

What are the current challenges in studying the bioenergetic role of nuoA in Y. pseudotuberculosis pathogenesis?

Researchers face several significant challenges when investigating nuoA's role in Y. pseudotuberculosis bioenergetics and pathogenesis:

Methodological Challenges:

• Functional Redundancy: Y. pseudotuberculosis possesses multiple respiratory enzymes that may compensate for nuoA mutations, complicating phenotypic analysis.

• Membrane Protein Complexity: As a membrane protein, nuoA is challenging to study in isolation while maintaining native structure and function.

• Multisubunit Complex: nuoA functions as part of the larger complex I, requiring reconstitution of the entire complex for comprehensive functional studies.

Experimental Approaches to Address Challenges:

• Conditional Knockdown Systems: Use of inducible promoters to control nuoA expression at different stages of infection.

• Bioenergetic Profiling: Employ techniques like Seahorse extracellular flux analysis to measure real-time changes in bacterial respiration.

• Bacterial Two-Hybrid Systems: Identify protein-protein interactions between nuoA and other bacterial or host proteins.

• In vivo Expression Technology (IVET): Determine whether nuoA is differentially expressed during infection.

Future Research Directions:

• Investigate potential moonlighting functions of nuoA beyond respiratory metabolism.

• Explore nuoA as a target for novel antimicrobials that selectively disrupt bacterial bioenergetics.

• Examine potential interactions between nuoA and host immune factors, particularly in phagocytes where respiratory burst activity may affect bacterial metabolism.

How might advances in structural biology techniques facilitate understanding of nuoA function in respiratory complex I?

Recent and emerging structural biology techniques offer powerful approaches to better understand nuoA function:

Cryo-Electron Microscopy (Cryo-EM):

• Enables visualization of intact complex I at near-atomic resolution without crystallization.

• Can capture different conformational states relevant to the catalytic cycle.

• Recent advances allow visualization of membrane proteins in lipid environments.

Integrative Structural Biology Approach:

• X-ray Crystallography: For high-resolution details of nuoA domains.

• NMR Spectroscopy: For dynamics and interaction studies, particularly for soluble domains.

• Molecular Dynamics Simulations: To predict conformational changes during electron transfer.

• Cross-linking Mass Spectrometry: To identify contact points between nuoA and other subunits.

Structural Insights and Functional Implications:

• Determining how nuoA participates in proton translocation across the membrane.

• Identifying key residues involved in quinone binding and electron transfer.

• Understanding how specific mutations might affect complex assembly or activity.

Technical Recommendations:

• Expression constructs should include purification tags that minimally impact structure.

• Consider nanodiscs or amphipols to stabilize the membrane protein for structural studies.

• Employ complementary biochemical approaches to validate structural findings.

How can gene editing techniques be optimized for studying nuoA function in Y. pseudotuberculosis?

Modern gene editing approaches offer powerful tools for investigating nuoA function:

CRISPR-Cas9 System Adaptation for Y. pseudotuberculosis:

• Guide RNA Design: Target unique regions of nuoA with minimal off-target effects.

• Delivery Methods: Optimize electroporation parameters specifically for Y. pseudotuberculosis serotype O:3.

• Selection Strategy: Use counterselectable markers (e.g., sacB) for scarless genome editing.

Site-Directed Mutagenesis Approach:

• Create point mutations in conserved residues to identify functionally critical amino acids.

• Design mutations that affect specific aspects of function (e.g., substrate binding vs. proton translocation).

Recommended Genetic Modifications:

• Deletion Mutants: Complete nuoA deletion to assess essentiality and phenotypic consequences.

• Domain Swapping: Replace domains with counterparts from other species to identify serotype-specific functions.

• Reporter Fusions: Create transcriptional or translational fusions to monitor expression patterns.

• Complementation Constructs: Develop plasmid-based expression systems for wild-type and mutant versions.

Validation Approaches:

• RT-qPCR to confirm transcriptional effects.

• Western blotting with specific antibodies to verify protein expression.

• Growth curves under different respiratory conditions to assess metabolic impact.

What are the emerging approaches for studying nuoA's potential role in antibiotic resistance mechanisms?

Investigating nuoA's connection to antibiotic resistance mechanisms is an emerging area with several promising research directions:

Hypothesis-Driven Approaches:

• Respiratory chain components like nuoA may influence membrane potential, affecting uptake of charged antibiotics.

• Alterations in electron transport could affect reactive oxygen species generation, modulating antibiotic-mediated killing.

Methodological Strategies:

• Minimum Inhibitory Concentration (MIC) Testing: Compare antibiotic susceptibility profiles between wild-type and nuoA-modified strains.

• Persister Cell Formation: Assess whether nuoA modifications affect the formation of antibiotic-tolerant persister cells.

• Membrane Potential Measurement: Use fluorescent dyes (e.g., DiSC3(5)) to measure changes in membrane potential.

• ROS Detection Assays: Quantify reactive oxygen species production using fluorescent probes like H2DCFDA.

Combination Approaches:

• Test synergy between respiratory chain inhibitors and conventional antibiotics against nuoA-modified strains.

• Investigate potential metabolic adaptations that may occur in response to nuoA modulation.

Translational Potential:

• Identification of nuoA inhibitors that potentiate antibiotic activity.

• Development of diagnostic tools to predict antibiotic susceptibility based on respiratory chain activity.

What is the recommended protocol for generating antibodies against recombinant Y. pseudotuberculosis nuoA for immunological studies?

The following comprehensive protocol outlines the generation of antibodies against recombinant nuoA:

Antigen Preparation:

• Express and purify recombinant nuoA with >90% purity as confirmed by SDS-PAGE.

• For hydrophobic regions, consider using synthetic peptides conjugated to carrier proteins (KLH or BSA).

• Select multiple antigenic regions for greatest specificity:

  • N-terminal region (amino acids 1-25)

  • Predicted extracellular loop (amino acids 80-100)

  • C-terminal region (amino acids 145-166)

Immunization Strategy:

• Animal Selection: Use rabbits for polyclonal antibodies or mice/rats for monoclonal antibody development.

• Primary Immunization: Emulsify 100-200 μg protein with complete Freund's adjuvant (1:1).

• Booster Immunizations: At 2, 4, and 6 weeks with incomplete Freund's adjuvant.

• Sampling: Collect serum samples before immunization (pre-immune) and 10 days after each boost.

Antibody Purification:

• Purify IgG fraction using protein A/G affinity chromatography.

• Perform affinity purification using immobilized recombinant nuoA.

Validation Tests:

• ELISA: Determine antibody titer and specificity.

• Western Blot: Confirm recognition of denatured protein.

• Immunofluorescence: Verify detection of native protein in bacterial cells.

• Immunoprecipitation: Test ability to pull down nuoA from bacterial lysates.

Cross-Reactivity Assessment:

• Test against related Y. pseudotuberculosis proteins (e.g., other Nuo subunits).

• Verify specificity against nuoA from different Yersinia species and serotypes.

What experimental approaches can be used to investigate potential interactions between nuoA and components of the host immune system?

Several experimental approaches can elucidate potential interactions between nuoA and host immune components:

In Vitro Binding Assays:

• Pull-down Assays: Use purified His-tagged nuoA as bait to identify interacting host proteins from cell lysates.

• Surface Plasmon Resonance (SPR): Measure binding kinetics between nuoA and candidate host proteins.

• ELISA-based Interaction Assays: Screen for binding to immune receptors such as Toll-like receptors (TLRs) or NOD-like receptors (NLRs).

Cell-Based Assays:

• Reporter Cell Lines: Use cells expressing pattern recognition receptors coupled to reporter genes to detect nuoA-mediated activation.

• Cytokine Profiling: Measure cytokine/chemokine production in immune cells exposed to purified nuoA.

• Flow Cytometry: Assess changes in surface marker expression on antigen-presenting cells.

Ex Vivo Models:

• Human PBMC Stimulation: Test immune cell activation and cytokine production.

• Neutrophil Functional Assays: Measure effects on phagocytosis, respiratory burst, and NETosis.

In Vivo Approaches:

• Transgenic Mouse Models: Use mice deficient in specific immune components to identify mechanisms of nuoA recognition.

• Bacterial Mutant Infection: Compare immune responses to wild-type versus nuoA-modified bacteria.

Imaging Techniques:

• Confocal Microscopy: Visualize co-localization of fluorescently labeled nuoA with immune cell receptors.

• Intravital Imaging: Track interactions in living tissues during infection.

This comprehensive approach can reveal whether nuoA serves as a pathogen-associated molecular pattern (PAMP) or otherwise modulates host immune responses during Y. pseudotuberculosis infection.