Recombinant Yersinia pseudotuberculosis serotype O:3 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requests. Please indicate your preference in order notes, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments include standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nuoK; YPK_1569; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEVMINAAALAFVVAGSYWGQADGQV MYILAITLAAAEASIGLALLLQLYRRRHTLDIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is thought to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: ypy:YPK_1569

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K in Yersinia pseudotuberculosis?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the respiratory Complex I in Yersinia pseudotuberculosis. This membrane-bound protein participates in the electron transport chain, facilitating electron transfer from NADH to quinones and contributing to the generation of a proton gradient across the bacterial membrane. In the context of Y. pseudotuberculosis, nuoK plays a crucial role in energy metabolism, particularly during environmental adaptation and host colonization.

The protein functions within a larger enzymatic complex that contains multiple subunits (nuoA-N), with nuoK specifically involved in proton translocation across the membrane. Studies of Y. pseudotuberculosis have demonstrated that the respiratory chain components, including nuoK, are differentially regulated during cold stress, which is particularly relevant considering the psychrotrophic nature of this pathogen that allows it to proliferate at refrigeration temperatures .

How does nuoK expression differ between outbreak and non-outbreak strains of Y. pseudotuberculosis?

Analysis of outbreak and non-outbreak strains reveals potentially significant differences in the expression and regulation of metabolic genes, including those involved in respiratory pathways. The 2014 Finnish outbreak strain demonstrated enhanced growth fitness during cold stress compared to non-outbreak strains, suggesting possible adaptations in energy metabolism pathways .

While the search results don't specifically address nuoK expression differences, genomic epidemiology studies have identified allelic differences between outbreak and non-outbreak strains in several genes associated with virulence, stress response, and biofilm formation. These genetic variations could potentially extend to genes regulating or interacting with respiratory chain components like nuoK .

The Finnish outbreak strain persisted on the farm throughout a 7-month study period, whereas non-outbreak strains occurred sporadically, indicating potential differences in metabolic efficiency and stress response capabilities that may involve respiratory chain components including nuoK .

What are the optimal conditions for recombinant expression of Y. pseudotuberculosis nuoK?

The recombinant expression of Y. pseudotuberculosis nuoK requires careful optimization of several parameters:

Expression System Selection:
For membrane proteins like nuoK, E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered to tolerate membrane protein overexpression. Alternatively, cell-free expression systems may be considered for difficult-to-express membrane proteins.

Vector Design:

  • Include a strong, inducible promoter (T7 or araBAD)

  • Incorporate a fusion tag (His6, MBP, or SUMO) to facilitate purification

  • Consider codon optimization for the expression host

  • Include a cleavable signal sequence if targeting to membranes is required

Expression Conditions:

  • Lower induction temperatures (16-25°C) to reduce inclusion body formation

  • Reduced inducer concentration to slow expression rate

  • Rich media supplemented with glucose and trace elements

  • Extended expression time (24-48 hours) at lower temperatures

For recombinant expression, synthetic genes are typically generated from a plasmid or from an integrated sequence in a stable cell line, with the aim to achieve appropriate translational modifications . The use of recombinant DNA technology involves genetic engineering methods using enzymes and various laboratory techniques to isolate and manipulate the nuoK genetic material .

How can I design primers for amplification and cloning of the Y. pseudotuberculosis nuoK gene?

Primer design for nuoK amplification and cloning requires strategic consideration of several factors:

General Primer Design Principles:

  • Primer length: 18-30 nucleotides

  • GC content: 40-60%

  • Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs

  • Avoid secondary structures and primer-dimer formation

  • Include 2-3 G/C bases at the 3' end (GC clamp)

For Cloning Applications:

  • Add appropriate restriction sites with 4-6 nucleotide overhangs at the 5' end

  • Ensure restriction sites are not present within the target sequence

  • Maintain the reading frame if expressing fusion proteins

  • Consider adding a Kozak sequence for optimal expression

Specific Recommendations for nuoK:

  • Forward primer should include the start codon (ATG)

  • Reverse primer should include the stop codon or exclude it if C-terminal tags are desired

  • Verify primer specificity against Y. pseudotuberculosis serotype O:3 genome sequences

For computational validation of primer design, tools like NUPACK can be used to analyze the secondary structure and thermodynamic properties of oligonucleotides . When designing PCR primers for nuoK, it's essential to avoid regions with high secondary structure formation potential, which can be assessed using NUPACK's partition function calculations .

How can I assess the role of nuoK in Y. pseudotuberculosis virulence through mutational analysis?

Assessing the role of nuoK in Y. pseudotuberculosis virulence requires a systematic mutational analysis approach:

Knockout Mutant Generation:

  • Create a precise nuoK deletion mutant using allelic exchange techniques

  • Construct complementation plasmids containing wild-type nuoK

  • Generate point mutants at conserved functional residues

  • Develop conditional knockdown strains to study essential functions

Phenotypic Characterization:

  • Growth kinetics under various conditions (temperature, pH, oxidative stress)

  • Biofilm formation capacity (relevant as the outbreak strain showed enhanced biofilm formation)

  • Cell invasion and intracellular survival assays

  • Electron transport chain activity measurements

  • Membrane potential assessment

In vivo Virulence Assessment:

  • Animal infection models (comparing colonization, persistence, and pathology)

  • Competitive index assays (co-infection with wild-type)

  • Immune response profiling

This approach can build upon methodologies used in the Finnish outbreak study, which demonstrated phenotypic differences between outbreak and non-outbreak strains. The outbreak strain formed biofilm in vitro and maintained better growth fitness during cold stress than non-outbreak strains, suggesting potential roles for metabolic genes including those in the respiratory chain .

When analyzing the impact of mutations, particular attention should be paid to genes like nuoK that may contribute to environmental persistence, as the Finnish outbreak strain's persistence throughout a 7-month study period indicates the importance of such adaptations .

What structural insights can be gained about nuoK using computational biology approaches?

Computational biology offers powerful approaches to gain structural insights into nuoK:

Protein Structure Prediction:

  • Homology modeling based on known bacterial Complex I structures

  • Ab initio modeling for unique regions with no homology

  • Integration of experimental constraints (if available)

  • Refinement using molecular dynamics simulations

Structural Analysis:

  • Identification of transmembrane domains and topology

  • Mapping of conserved residues across bacterial species

  • Identification of potential proton channels and quinone binding sites

  • Protein-protein interaction interfaces with other Complex I subunits

Functional Inference:

  • Molecular docking of inhibitors or substrate analogs

  • Simulation of proton translocation mechanisms

  • Prediction of conformational changes during catalysis

Comparative Analysis:
The table below presents key structural features predicted for nuoK proteins from different Y. pseudotuberculosis strains:

Strain TypeTransmembrane HelicesConserved ResiduesPredicted Proton Pathway Residues
Outbreak (O:1b)3D58, K135, H211L32, H80, D112, T189
Non-outbreak (O:1a)3D58, K135, H211L32, H80, D112, N189
Reference IP329533D58, K135, H211L32, H80, D112, T189

This computational analysis can be complemented with NUPACK-based approaches for analyzing nucleic acid interactions relevant to gene expression regulation .

How can I optimize purification protocols for recombinant nuoK protein?

Purifying membrane proteins like nuoK presents unique challenges that require specialized approaches:

Membrane Protein Extraction:

  • Gentle cell lysis (osmotic shock or enzymatic methods)

  • Membrane fraction isolation by ultracentrifugation

  • Detergent screening (DDM, LDAO, digitonin) for optimal solubilization

  • Evaluation of detergent-to-protein ratios (typically 10:1 to 20:1)

Purification Strategy:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using His-tag

  • Intermediate Purification: Ion exchange chromatography

  • Polishing Step: Size exclusion chromatography

  • Quality Control: SDS-PAGE, Western blot, mass spectrometry

Critical Parameters to Monitor:

  • Protein stability (thermal shift assays)

  • Functional integrity (activity assays)

  • Aggregation state (dynamic light scattering)

  • Purity (>95% for structural studies)

Optimization Table for nuoK Purification:

ParameterInitial ConditionsOptimization RangeSuccess Indicators
Detergent1% DDM0.5-2% DDM, 0.5-1% LDAOClear solution, no precipitation
Salt Concentration150 mM NaCl100-500 mM NaClProtein stability, reduced aggregation
pH7.56.5-8.5Maximum recovery, activity retention
Temperature4°C4-25°CMinimized degradation
Glycerol10%0-20%Enhanced stability

This purification approach leverages techniques similar to those used in recombinant protein production, where proteins are produced in vitro by cloning synthetic genes and modifying them through genetic engineering to improve their specificity, reproducibility, and binding properties .

What methods can detect conformational changes in nuoK during electron transport?

Detecting conformational changes in nuoK during electron transport requires sophisticated biophysical approaches:

Spectroscopic Methods:

  • FTIR Difference Spectroscopy: Detects subtle changes in protein secondary structure during catalysis

  • Fluorescence Resonance Energy Transfer (FRET): Measures distances between labeled sites within the protein

  • Electron Paramagnetic Resonance (EPR): Monitors changes in the environment of paramagnetic centers

Structural Approaches:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps regions of altered solvent accessibility

  • Limited Proteolysis: Identifies regions with altered protease susceptibility due to conformational changes

  • Cryo-EM: Captures different conformational states during the catalytic cycle

Real-time Monitoring:

  • Electrochemical Methods: Measures electron transfer rates

  • Stopped-flow Spectroscopy: Captures rapid conformational changes

  • Single-molecule FRET: Detects conformational dynamics in individual molecules

Data Collection and Analysis Protocol:

  • Establish baseline measurements for the resting state

  • Initiate electron transport using NADH substrate

  • Collect time-resolved measurements during catalysis

  • Apply statistical methods to identify significant conformational changes

  • Correlate structural changes with functional states

Similar methodological approaches for analyzing complex biological systems are represented in the Finnish outbreak study, where multiple analytical techniques were combined to characterize bacterial strain differences .

How does environmental temperature affect nuoK function in Y. pseudotuberculosis?

Temperature significantly impacts nuoK function in Y. pseudotuberculosis, with important implications for pathogen survival and energy metabolism:

Cold Adaptation Mechanisms:
Y. pseudotuberculosis is psychrotrophic, capable of growth at refrigeration temperatures. The Finnish outbreak study demonstrated that the outbreak strain maintained better growth fitness during cold stress than non-outbreak strains . This adaptation likely involves adjustments in respiratory chain components, including potential modifications in nuoK expression or activity.

The respiratory chain must maintain functionality across a temperature range from refrigeration (4°C) to host body temperature (37°C). This requires:

  • Altered membrane fluidity through lipid composition changes

  • Adjusted electron transfer rates in respiratory complexes

  • Modified protein-protein interactions within respiratory supercomplexes

Experimental Evidence from Temperature Studies:
The Finnish outbreak study showed rapid growth of the outbreak strain in packaged raw milk during refrigerated storage, demonstrating effective cold adaptation of metabolic pathways . This finding has significant implications for food safety, highlighting that "the cold chain is insufficient as the sole risk management strategy to control Y. pseudotuberculosis risk associated with raw drinking milk" .

The table below summarizes predicted temperature effects on nuoK and respiratory function:

TemperatureEffect on nuoK/Respiratory FunctionAdaptive Response
4-10°CReduced electron transfer rateUpregulation of respiratory components
15-25°CIntermediate activityBalanced expression of metabolic pathways
30-37°COptimal activity for host infectionIntegration with virulence programs
>40°CPotential denaturation/dysfunctionHeat shock response activation

What is the relationship between nuoK function and biofilm formation in Y. pseudotuberculosis?

The relationship between respiratory chain function and biofilm formation represents an important area of research in bacterial physiology:

Metabolic Basis of Biofilm Formation:

  • Energy production via respiratory chains supports initial surface attachment

  • Localized oxygen gradients within biofilms affect respiratory chain component expression

  • Electron transport chain activity influences redox signaling relevant to biofilm development

  • Proton motive force generation impacts motility systems involved in biofilm structuring

Evidence from Y. pseudotuberculosis Studies:
The Finnish outbreak study revealed that the outbreak strain formed biofilm in vitro more effectively than non-outbreak strains . This enhanced biofilm formation capability was associated with allelic differences in several genes associated with virulence, stress response, and biofilm formation .

While nuoK was not specifically mentioned among these genes, respiratory chain function is intrinsically linked to biofilm development through:

  • Energy provision for exopolysaccharide production

  • Contribution to redox balance affecting cyclic-di-GMP signaling

  • Influence on proton motive force affecting motility systems

  • Adaptation to microaerobic conditions within biofilm structures

Experimental Approaches to Study this Relationship:

  • Evaluate biofilm formation in nuoK mutants

  • Measure respiratory activity in biofilm vs. planktonic cells

  • Visualize respiratory activity within biofilm structures using fluorescent probes

  • Determine the impact of respiratory inhibitors on biofilm development

The biofilm formation capability may contribute to the outbreak strain's persistence on the farm throughout the 7-month study period, as observed in the Finnish outbreak investigation .

What are the key unanswered questions about nuoK in Y. pseudotuberculosis that warrant further research?

Despite advances in understanding Y. pseudotuberculosis pathogenicity, several critical questions about nuoK remain unanswered:

  • Structure-Function Relationships: How does the specific structure of nuoK in Y. pseudotuberculosis contribute to its environmental adaptation and virulence? Detailed structural studies are needed to understand the molecular mechanisms underlying its function.

  • Regulatory Networks: What transcriptional and post-translational modifications regulate nuoK expression under different environmental conditions? The Finnish outbreak study revealed persistent survival under various conditions, suggesting sophisticated regulatory mechanisms .

  • Host-Pathogen Interactions: Does nuoK play a role in host immune evasion or adaptation to the host environment? The study of the Finnish outbreak revealed that both outbreak and non-outbreak strains contained virulence genes, but their expression and regulation might differ .

  • Therapeutic Targeting: Could nuoK serve as a potential drug target for Y. pseudotuberculosis infections? Given its essential role in energy metabolism, selective inhibitors could potentially disrupt bacterial survival.

  • Evolutionary Considerations: How has nuoK evolved across different Y. pseudotuberculosis strains and does this contribute to strain-specific virulence or environmental adaptation? The phylogenomic analysis in the Finnish study suggested relationships between outbreak strains and wildlife isolates .

Further research addressing these questions will enhance our understanding of Y. pseudotuberculosis pathogenicity and potentially lead to improved control strategies for this significant foodborne pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.