Recombinant Yersinia pseudotuberculosis serotype O:3 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Yersinia pseudotuberculosis serotype O:3 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Recombinant Yersinia pseudotuberculosis serotype O:3 p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) is a protein involved in the efflux of p-hydroxybenzoic acid (pHBA) in Yersinia pseudotuberculosis . AaeA, also known as pHBA efflux pump protein A, is encoded by the aaeA gene and functions as a subunit of the efflux pump . Efflux pumps are crucial for bacterial resistance to various compounds, including antibiotics and other toxic substances, by actively transporting these substances out of the cell .

Basic Information

FeatureDescription
Protein NameRecombinant Full Length Yersinia pseudotuberculosis serotype O:3 P-Hydroxybenzoic Acid Efflux Pump Subunit AaeA(AaeA) Protein, His-Tagged
SynonymsaaeA; YPK_0484; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
SourceE. coli
SpeciesYersinia pseudotuberculosis serotype O:3
TagHis (N-terminal)
Protein LengthFull Length (1-311 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol for long-term storage at -20℃/-80℃
Gene NameaaeA
UniProt IDB1JKI2
AA SequenceMSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSDASKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQVSPMTKLMHRLREFG

Gene Information

The aaeA gene, also known as YPK_0484, encodes the p-hydroxybenzoic acid efflux pump subunit AaeA in Yersinia pseudotuberculosis . The gene is responsible for the production of the AaeA protein, which is a key component of the efflux pump system involved in the transport of pHBA .

Protein sequence

The amino acid sequence of Recombinant Full Length Yersinia pseudotuberculosis serotype O:3 P-Hydroxybenzoic Acid Efflux Pump Subunit AaeA(AaeA) Protein is :

MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSDASKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQVSPMTKLMHRLREFG

Biological Role and Significance

The AaeA protein plays a crucial role in the efflux of p-hydroxybenzoic acid in Yersinia pseudotuberculosis . Efflux pumps are essential for bacterial survival as they provide resistance against toxic compounds and contribute to the pathogenicity of bacteria .

Function and Mechanism

AaeA functions as a subunit of an efflux pump, which is responsible for transporting p-hydroxybenzoic acid out of the bacterial cell . This efflux mechanism helps the bacteria to maintain intracellular homeostasis and resist the toxic effects of pHBA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
aaeA; YPK_0484; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
aaeA
Target Protein Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQVSPM TKLMHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: ypy:YPK_0484

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and what is its role in Yersinia pseudotuberculosis?

The AaeA protein in Y. pseudotuberculosis functions as a membrane fusion protein component of the p-hydroxybenzoic acid efflux pump system. Similar to its characterized homolog in E. coli, AaeA forms part of a multicomponent system that exports potentially toxic aromatic carboxylic acids from the bacterial cytoplasm. The protein was originally designated as YhcQ in E. coli before being renamed to reflect its functional role in aromatic acid efflux . In the genomic context of Y. pseudotuberculosis YPIII (serotype O:3), the aaeA gene is part of the 4,192 protein-coding genes identified in this organism's 4,689,441 nucleotide genome . The AaeA subunit works in conjunction with the AaeB component to form a functional efflux system that contributes to bacterial survival under specific stress conditions.

How does the AaeA-containing efflux system contribute to bacterial acid stress response?

The AaeA-containing efflux system represents one of several mechanisms that enteric bacteria like Y. pseudotuberculosis employ to survive acidic conditions encountered during host infection. While Y. pseudotuberculosis possesses multiple acid survival systems, including the well-characterized aspartate-dependent mechanism involving aspartase (AspA) , the AaeA efflux pump plays a complementary role in acid stress response. Based on findings from E. coli, this efflux system functions as a "metabolic relief valve" that alleviates toxic effects resulting from imbalanced metabolism under stress conditions . The system specifically removes aromatic carboxylic acids like p-hydroxybenzoic acid (pHBA), which can accumulate to toxic levels during metabolic perturbations associated with acid stress. This detoxification mechanism contributes to the bacterium's ability to survive the gastric acidity barrier, which is essential for food-borne pathogens to establish successful infections .

What is the genetic organization of the aaeA gene and associated regulatory elements?

The genetic architecture of the aaeA locus in Y. pseudotuberculosis mirrors what has been described in E. coli, though with species-specific variations. In E. coli, the gene exists within an operon structure containing multiple components:

Gene designationFormer nameEncoded protein function
aaeRyhcSLysR-family transcriptional regulator
aaeXyhcRSmall protein of unknown function
aaeAyhcQMembrane fusion protein
aaeByhcPEfflux pump protein

The aaeR gene is divergently transcribed from the aaeXAB genes, and its product regulates expression of these structural genes . Similar organization likely exists in Y. pseudotuberculosis, with the regulatory protein controlling expression in response to aromatic carboxylic acid inducers. The genome of Y. pseudotuberculosis YPIII contains the genetic components for this system, which are integrated into the organism's complex network of stress response mechanisms .

What expression systems are used for producing recombinant AaeA protein for research purposes?

Recombinant AaeA protein can be successfully expressed using E. coli-based expression systems, which provide efficient production for structural and functional studies. The documented approach includes:

Expression parameterRecommended conditions
Expression hostE. coli
Vector typepET-based with N-terminal His-tag
Protein lengthFull length (1-311 amino acids)
Purification strategyImmobilized metal affinity chromatography
Storage formLyophilized powder
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage conditions-20°C/-80°C, avoiding repeated freeze-thaw cycles

This expression system yields protein with greater than 90% purity as determined by SDS-PAGE analysis . For functional studies, researchers should consider maintaining the native structure by avoiding detergents that might disrupt membrane protein conformation unless specifically needed for solubilization experiments.

How do mutations in the aaeA gene affect bacterial sensitivity to p-hydroxybenzoic acid and other aromatic compounds?

Genetic manipulation studies in E. coli have demonstrated that mutations in the efflux pump components, including the aaeA homolog (yhcQ), result in significantly increased sensitivity to p-hydroxybenzoic acid (pHBA) . By extension, similar mutations in Y. pseudotuberculosis would likely produce comparable phenotypes. Experimental evidence indicates that:

  • Deletion mutants lacking functional aaeA exhibit hypersensitivity to pHBA, with growth inhibition occurring at substantially lower concentrations compared to wild-type strains .

  • The regulatory gene aaeR (yhcS) is also critical, as aaeR mutants display hypersensitivity to pHBA similar to structural gene mutants .

  • Complementation experiments demonstrate that expression of both aaeA and aaeB is necessary and sufficient to restore normal pHBA tolerance in mutant strains .

These findings suggest that the AaeA protein plays an essential and non-redundant role in aromatic acid resistance, despite the presence of other efflux systems in these bacteria. The specificity of this system appears relatively narrow, as only a select subset of aromatic carboxylic acids among hundreds of diverse compounds tested were identified as substrates for this efflux system .

What experimental approaches are most effective for studying AaeA function and regulation in vitro?

Multiple complementary experimental approaches have proven effective for investigating AaeA function and regulation:

Experimental approachMethodologyResearch applications
Proteomic analysis2D-gel electrophoresis with mass spectrometryIdentification of AaeA expression changes under various stress conditions
Gene expression analysislacZ fusion constructsQuantitative assessment of aaeA promoter activity in response to potential inducers
Knockout mutagenesisHomologous recombination or CRISPR-Cas9Creation of aaeA deletion mutants to assess phenotypic consequences
Acid survival assaysExposure to defined pH with/without amino acids or aromatic compoundsQuantification of survival rates under acid stress conditions
Recombinant protein studiesExpression and purification of His-tagged AaeAStructural analysis and in vitro reconstitution of efflux activity
Substrate specificity profilingGrowth inhibition assays with candidate compoundsIdentification of natural substrates of the AaeA-containing efflux system

These approaches can be integrated to develop a comprehensive understanding of AaeA function. For instance, researchers studying the aspartate-dependent acid survival system in Y. pseudotuberculosis successfully combined proteomic analysis, lacZ fusion studies, and acid survival assays to characterize the role of aspartase in acid protection . Similar multifaceted approaches would be valuable for elucidating AaeA's precise function in aromatic acid efflux and acid stress response.

How does the AaeA efflux system interact with other acid stress response mechanisms in Y. pseudotuberculosis?

Y. pseudotuberculosis employs multiple acid survival strategies that likely function in a coordinated manner to protect against environmental acid stress. The relationship between these systems appears complex:

  • The aspartate-dependent acid survival system involves aspartase (AspA), which increases under acidic conditions and produces ammonia that helps neutralize internal pH .

  • The AaeA-containing efflux system removes potentially toxic aromatic compounds that may accumulate during acid stress .

  • These systems likely complement other acid response mechanisms described in enteric bacteria, including amino acid-dependent and -independent acid resistance systems .

While direct experimental evidence of interaction between these systems in Y. pseudotuberculosis is limited in the available literature, the regulatory networks governing stress responses typically involve cross-talk between different protective mechanisms. Future research directions should include investigating potential synergistic effects between the AspA-mediated and AaeA-mediated protection systems, perhaps through the construction and characterization of double mutants lacking both systems.

How does serotype variation affect AaeA structure and function across different Y. pseudotuberculosis strains?

Serotype variation in Y. pseudotuberculosis primarily reflects differences in surface structures, particularly O-antigen components of lipopolysaccharide. While the specific impact of serotype differences on AaeA structure and function has not been extensively characterized, several considerations are relevant:

SerotypeGenome characteristicsPotential impact on AaeA
O:3 (YPIII)4,689,441 nucleotides with 4,192 protein-coding genes Reference strain with documented acid resistance mechanisms
O:1bAaeA protein characterized with complete 311 amino acid sequence May exhibit subtle functional differences due to sequence variations
Other serotypesVariable genomic contentPotentially different regulatory networks affecting aaeA expression

Comparative genomic analysis of different Y. pseudotuberculosis serotypes would reveal the degree of conservation in the aaeA gene and its regulatory elements. While core metabolic functions like efflux systems tend to be conserved across serotypes, variations in expression patterns or fine-tuned substrate specificities might exist. Experimental approaches to address this question would include heterologous expression studies where aaeA genes from different serotypes are expressed in a common genetic background to assess functional differences.

What is the three-dimensional structure of AaeA and how does it contribute to substrate recognition and transport?

The three-dimensional structure of Y. pseudotuberculosis AaeA has not been experimentally determined, representing a significant knowledge gap in understanding this protein's function. Based on its classification as a membrane fusion protein and sequence analysis, researchers can make several predictions:

  • AaeA likely contains an N-terminal membrane anchor followed by a periplasmic domain.

  • The periplasmic portion probably adopts a structure featuring a mixture of α-helices and β-sheets.

  • Conserved residues across homologous proteins likely form binding sites for aromatic carboxylic acid substrates.

Advanced structural biology techniques that would address this knowledge gap include:

  • X-ray crystallography of the purified protein or its soluble domains

  • Cryo-electron microscopy of the assembled efflux complex

  • Nuclear magnetic resonance spectroscopy of specific domains

  • Computational approaches including homology modeling based on structurally characterized homologs

Understanding the three-dimensional structure would provide critical insights into substrate binding specificity, the mechanism of transport facilitation, and potential targets for inhibitor development. Integrating structural data with functional assays would also clarify how AaeA coordinates with AaeB to achieve efficient efflux of aromatic carboxylic acids.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.