Recombinant Yersinia pseudotuberculosis serotype O:3 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Mechanism

ArnE functions as part of a heterodimeric flippase complex (ArnE/ArnF) that transports 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic leaflet of the inner membrane . This translocation enables the transfer of L-Ara4N to lipid A, a key component of lipopolysaccharide (LPS), via the glycosyltransferase ArnT . The modification neutralizes the negative charge of lipid A, thereby conferring resistance to CAMPs .

Key Features of ArnE:

PropertyDetail
Gene LocationPart of the arn operon in Y. pseudotuberculosis O:3
Protein FamilyEamA-like transporter family
Subunit PartnersArnF (forms a functional flippase complex)
Substrate Specificityα-L-Ara4N-phosphoundecaprenol

Sequence and Domains:

  • Primary Sequence: Conserved transmembrane domains critical for flippase activity .

  • Structural Motifs: Predicted 6–8 transmembrane helices, typical of lipid flippases .

Applications in Research and Vaccine Development

ArnE’s role in lipid A modification has implications for both bacterial pathogenesis and vaccine design:

Pathogenesis Studies

  • Antimicrobial Resistance: Y. pseudotuberculosis mutants lacking arnE show increased susceptibility to polymyxin B .

  • Host-Pathogen Interaction: Lipid A arabinosylation aids bacterial evasion of innate immune responses during infection .

Vaccine Engineering

Recombinant Y. pseudotuberculosis strains engineered to overexpress ArnE and produce monophosphoryl lipid A (MPLA) have been used to generate outer membrane vesicles (OMVs) enriched with Yersinia pestis antigens (e.g., LcrV). These OMVs elicit robust immune responses and provide protection against plague in murine models :

Vaccine ComponentEfficacy (Mouse Model)Reference
OMV YptbS44-Bla-V100% protection (pulmonary challenge)
OMV YptbS45-Bla-V90% protection (pulmonary challenge)

Future Directions

Current research focuses on:

  • Structural Resolution: Cryo-EM studies to elucidate the flippase mechanism .

  • Therapeutic Targeting: Inhibitors of ArnE/ArnF to counteract antimicrobial resistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please specify it when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the liquid form has a shelf life of 6 months at -20°C/-80°C, while the lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; YPK_1836; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
arnE
Target Protein Sequence
MNSYLLLPMVSLLTCIGQLCQKQAAQCWEQPQARRLNLTLRWLAIAVVSLGLGMLLWLRL LQQLPLSVAYPMLSFNFVLVTLAAQLFYGEKATLRHWLGVAAIMFGILLMSWHL
Uniprot No.

Target Background

Function
This protein acts as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: ypy:YPK_1836

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ArnE in Yersinia pseudotuberculosis?

ArnE functions as a subunit of a putative flippase complex with ArnF (also known as PmrL/M heterodimer) in Y. pseudotuberculosis. This complex is responsible for translocating (flipping) bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N) from the cytoplasmic side to the periplasmic side of the inner membrane . This translocation is a critical step in the pathway for the modification of lipid A with 4-aminoarabinose (Ara4N), which contributes to resistance against cationic antimicrobial peptides and polymyxin antibiotics in Gram-negative bacteria .

The arnE gene is part of the arnBCADTEF operon (also known as pmrHFIJKLM operon in some bacteria), which encodes all the proteins necessary for the synthesis and transfer of Ara4N to lipid A . The flippase activity is essential because the Ara4N modification is synthesized in the cytoplasm, but the final transfer to lipid A by ArnT occurs in the periplasm.

How does the arn operon contribute to antimicrobial resistance in Y. pseudotuberculosis?

The arn operon in Y. pseudotuberculosis plays a crucial role in conferring resistance to cationic antimicrobial peptides and polymyxin antibiotics through the following mechanism:

  • The products of the arnBCADTEF operon synthesize and transfer 4-amino-4-deoxy-L-arabinose (Ara4N) to lipid A in the bacterial outer membrane .

  • This modification adds a positive charge to lipid A, reducing the net negative charge of the bacterial surface.

  • The reduction in negative charge decreases the binding affinity of cationic antimicrobial peptides and polymyxin antibiotics to the bacterial membrane.

  • As a result, these antimicrobial agents become less effective against the bacteria.

The pathway involves multiple steps:

  • ArnB and ArnA (PmrI and PmrH) are involved in the initial synthesis of the modified arabinose

  • ArnC (PmrF) transfers the 4-formamido-arabinose to bactoprenyl monophosphate

  • ArnD (PmrJ) deformylates the intermediate to produce bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N)

  • ArnE/F (PmrL/M) then flips this molecule to the periplasm

  • Finally, ArnT (PmrK) transfers Ara4N from BP-Ara4N to lipid A

This complete pathway is essential for full resistance to polymyxins and related antimicrobial compounds.

What methods are appropriate for detecting ArnE expression in Y. pseudotuberculosis?

Several methods can be employed to detect ArnE expression in Y. pseudotuberculosis:

  • RT-qPCR: Quantitative reverse transcription PCR can measure arnE mRNA levels, allowing for the assessment of gene expression under different conditions. This approach is particularly useful for studying the regulation of the arn operon in response to environmental stimuli.

  • Western Blotting: Using antibodies specific to ArnE or epitope-tagged versions of ArnE. As demonstrated with other Arn proteins, anti-His Western blotting has been successfully used for detecting expressed and purified proteins from the arn operon .

  • Mass Spectrometry: Proteomic approaches using liquid chromatography coupled with mass spectrometry (LC-MS) can detect and quantify ArnE in membrane fractions.

  • Fluorescent Protein Fusions: Creating translational fusions between ArnE and fluorescent proteins like GFP can allow visualization of expression and localization using fluorescence microscopy.

  • Reporter Gene Assays: Fusing the arnE promoter to reporter genes like lacZ or luciferase can enable the monitoring of arnE expression in different conditions.

When performing these analyses, it's important to consider that the expression of the arn operon is typically induced under specific conditions, such as growth in the presence of Fe³⁺ or in low Mg²⁺ environments that activate the PhoP/PhoQ and PmrA/PmrB two-component systems .

What are the experimental approaches for studying the flippase activity of the ArnE/F complex?

Studying the flippase activity of the ArnE/F complex presents significant challenges due to the membrane-embedded nature of these proteins and the difficulty in directly observing the translocation of lipid-linked substrates. Several experimental approaches can be employed:

  • Genetic complementation studies:

    • Creating knockout mutants of arnE and/or arnF

    • Measuring the resulting changes in Ara4N modification of lipid A

    • Complementing with wild-type or mutated versions of the genes

  • Liposome reconstitution assays:

    • Purifying ArnE and ArnF proteins

    • Reconstituting them into liposomes with fluorescently labeled BP-Ara4N substrates

    • Monitoring substrate translocation across the membrane

  • ESI-LC-MS analysis of lipid intermediates:

    • Similar to the methods used for studying ArnD function, electrospray ionization-liquid chromatography-mass spectrometry (ESI-LC-MS) can be used to detect and quantify the lipid intermediates involved in the Ara4N modification pathway

    • This involves:

      • Extraction of lipids from bacterial membranes

      • Analysis using ESI-LC-MS in negative ion mode

      • Identification of BP-Ara4N and related intermediates

  • Fluorescent bactoprenyl substrate analogs:

    • Using synthetic fluorescent analogs of bactoprenyl phosphate (e.g., 2CN-BP) as substrates

    • Monitoring their flipping across membranes in reconstituted systems

  • Site-directed mutagenesis:

    • Introducing specific mutations in conserved regions of ArnE and ArnF

    • Assessing the impact on flippase activity and antimicrobial resistance

A comprehensive approach would include correlation of in vitro flippase activity with in vivo phenotypes such as polymyxin resistance levels, validating the functional significance of the observed activities.

How do mutations in arnE affect the pathogenicity of Y. pseudotuberculosis?

Mutations in arnE can significantly impact the pathogenicity of Y. pseudotuberculosis through multiple mechanisms:

  • Altered antimicrobial resistance:

    • Disruption of arnE impairs the flippase function necessary for lipid A modification with Ara4N

    • This reduces resistance to host-derived antimicrobial peptides found in various tissues and secretions

    • Y. pseudotuberculosis with arnE mutations would show increased susceptibility to innate immune defenses

  • Changes in inflammatory response:

    • Lipid A modifications alter the structure of lipopolysaccharide (LPS), a potent immunostimulatory molecule

    • Modified LPS can trigger different patterns of cytokine production from host immune cells

    • This may affect the characteristic inflammatory response seen in Y. pseudotuberculosis infections, including those causing Far East scarlet-like fever (FESLF)

  • Impact on colonization and persistence:

    • Y. pseudotuberculosis infects a diverse range of hosts including humans, livestock, pets, wild animals, and zoo animals

    • Reduced antimicrobial peptide resistance due to arnE mutations may impair colonization of these various hosts

    • This could affect the organism's ability to persist in environmental reservoirs

  • Interaction with virulence determinants:

    • Y. pseudotuberculosis possesses multiple virulence determinants, including those encoded on the chromosome and on plasmids

    • The LPS structure affected by ArnE activity may influence the function of other virulence factors such as adhesins, invasins, and secretion systems

Research approaches to study these effects would include:

  • Creation of isogenic arnE knockout mutants

  • Animal infection models comparing wild-type and mutant strains

  • Transcriptomic and proteomic analyses to identify compensatory mechanisms

  • Immune cell stimulation assays to determine differences in inflammatory response

What is the role of ArnE in the complete Ara4N-lipid A modification pathway?

The role of ArnE in the complete Ara4N-lipid A modification pathway is critical as it forms part of the membrane translocation machinery. Here is a detailed overview of the entire pathway and ArnE's specific role:

Complete Ara4N-lipid A modification pathway:

  • UDP-Glucuronic acid conversion - PmrE (UDP-glucose dehydrogenase) converts UDP-glucose to UDP-glucuronic acid

  • Ara4N precursor synthesis - ArnA (PmrH) and ArnB (PmrI) convert UDP-glucuronic acid to UDP-4-amino-4-deoxy-L-arabinose (UDP-Ara4N)

  • Formation of lipid carrier intermediate - ArnC (PmrF) transfers the 4-formamido-arabinose moiety from UDP-Ara4FN to bactoprenyl monophosphate (BP), creating bactoprenyl monophosphate-4-formamido-arabinose (BP-Ara4FN)

  • Deformylation - ArnD (PmrJ) deformylates BP-Ara4FN to produce bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N)

    • This step is critical as it commits the pathway to lipid A modification and prevents reversal of the ArnC reaction

    • ArnD contains a metal coordination H-H-D triad active site and functions efficiently in the presence of Co²⁺ or Mn²⁺

  • Membrane translocation - ArnE and ArnF (PmrL and PmrM) form a heterodimeric flippase complex that translocates BP-Ara4N from the cytoplasmic face to the periplasmic face of the inner membrane

    • This translocation step is essential because:

      • Synthesis of BP-Ara4N occurs in the cytoplasm

      • The target lipid A is located on the outer leaflet of the inner membrane

      • ArnT, which transfers Ara4N to lipid A, functions in the periplasm

  • Transfer to lipid A - ArnT (PmrK) transfers the Ara4N moiety from BP-Ara4N to lipid A

    • ArnT can also catalyze a reverse reaction, transferring Ara4N from lipid A to bactoprenyl phosphate

The complexity of this pathway is highlighted by the fact that disruption at any step, including ArnE function, can lead to loss of Ara4N modification and subsequent increase in susceptibility to cationic antimicrobial peptides and polymyxins.

What biosafety requirements must be followed when working with recombinant Y. pseudotuberculosis?

Working with recombinant Y. pseudotuberculosis requires strict adherence to biosafety regulations, particularly the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. The following requirements must be followed:

The institution must ensure that all research conducted at or sponsored by the institution, regardless of funding source, complies with the NIH Guidelines . Non-compliance can result in suspension, limitation, or termination of NIH funds for recombinant DNA research at the institution .

What methods can be used to detect and quantify Ara4N modification of lipid A in Y. pseudotuberculosis?

The detection and quantification of Ara4N modification of lipid A in Y. pseudotuberculosis can be accomplished through several analytical methods:

  • Mass Spectrometry-Based Approaches:

    • ESI-LC-MS (Electrospray Ionization-Liquid Chromatography-Mass Spectrometry):

      • Lipid A is extracted from bacterial cells using modified Bligh and Dyer method

      • Samples are analyzed in negative ion mode

      • Ara4N-modified lipid A shows characteristic mass shifts (+131 Da per Ara4N group)

      • Selected Ion Monitoring (SIM) can be used for targeted analysis

    • MALDI-TOF MS (Matrix-Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry):

      • Rapid analysis of lipid A modifications

      • Comparison of mass spectra between wild-type and arnE mutant strains

      • Detection of mass shifts corresponding to Ara4N addition

  • Biochemical and Chromatographic Methods:

    • TLC (Thin-Layer Chromatography):

      • Separation of lipid A species based on polarity

      • Detection with specific stains or autoradiography if radiolabeled precursors are used

    • Polymyxin Binding Assays:

      • Quantitative assessment of polymyxin resistance as an indirect measure of Ara4N modification

      • Fluorescently-labeled polymyxin can be used to measure binding to bacterial cells

  • Genetic Reporter Systems:

    • Construction of transcriptional/translational fusions to monitor arn operon expression

    • Correlation of expression levels with direct measurements of Ara4N modification

  • Pathway Intermediate Analysis:

    • Detection of bactoprenyl monophosphate-4-aminoarabinose (BP-Ara4N) using ESI-LC-MS

    • Analysis of lipid extracts from wild-type and arnE mutant strains to detect accumulation of pathway intermediates

    • Comparison with standards or control samples from strains with known modifications

  • NMR Spectroscopy:

    • Structural analysis of purified lipid A

    • Detection of Ara4N modification through characteristic chemical shifts

A comprehensive approach might involve:

  • Induction of the arn operon by growing bacteria in the presence of Fe³⁺

  • Extraction of lipid A using established protocols

  • Mass spectrometric analysis to detect and quantify Ara4N-modified species

  • Correlation with functional assays such as polymyxin susceptibility testing

How can recombinant DNA techniques be applied to study arnE function in Y. pseudotuberculosis?

Recombinant DNA techniques offer powerful approaches to study arnE function in Y. pseudotuberculosis. Here are methodological strategies that can be employed:

  • Gene Knockout and Complementation Studies:

    • Allelic exchange mutagenesis:

      • Creation of arnE deletion mutants using suicide vectors

      • Verification of deletion by PCR and sequencing

      • Phenotypic characterization including antimicrobial susceptibility testing

    • Complementation analysis:

      • Reintroduction of wild-type arnE on a plasmid vector

      • Use of inducible promoters to control expression levels

      • Assessment of restored function through polymyxin resistance assays

  • Protein Expression and Purification:

    • Heterologous expression systems:

      • Expression of ArnE with affinity tags (His, GST, etc.) in E. coli

      • Optimization of membrane protein expression using specialized strains

      • Co-expression with ArnF to study the complete flippase complex

    • Purification strategies:

      • Membrane protein solubilization using appropriate detergents

      • Affinity chromatography and size exclusion chromatography

      • Verification of purified protein by SDS-PAGE and Western blotting

  • Site-Directed Mutagenesis:

    • Identification of conserved amino acids through sequence alignment

    • Creation of point mutations to identify functionally important residues

    • Assessment of mutant protein function in vivo and in vitro

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid systems to study ArnE-ArnF interactions

    • Co-immunoprecipitation to identify interaction partners

    • Cross-linking studies to capture transient interactions in the membrane

  • Functional Reconstitution:

    • Reconstitution of purified ArnE and ArnF into liposomes

    • Development of in vitro assays to measure flippase activity

    • Use of fluorescent BP analogs to monitor translocation

  • Localization Studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Immunogold electron microscopy for high-resolution localization

    • Fractionation studies to confirm membrane association

  • Transcriptional Analysis:

    • RNA-Seq to identify genes co-regulated with arnE

    • ChIP-Seq to identify transcription factors controlling arnE expression

    • Promoter-reporter fusions to study regulation under different conditions

Each of these approaches must be conducted in accordance with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, with appropriate biosafety measures and institutional approvals .

How does ArnE in Y. pseudotuberculosis compare to homologs in other bacterial species?

The ArnE protein in Y. pseudotuberculosis shares significant homology with its counterparts in other bacterial species, but with important distinctions that reflect evolutionary adaptations to different ecological niches and pathogenic lifestyles:

  • Comparison with Y. pestis ArnE:

    • Nearly identical protein sequences reflecting the recent evolutionary divergence

    • Y. pestis is a recently emerged clone of Y. pseudotuberculosis that diverged within the last 1,500 to 20,000 years

    • Despite genetic similarity, expression patterns may differ due to distinct regulatory networks in the two species

  • Comparison with Y. enterocolitica ArnE:

    • More divergent sequence compared to the Y. pestis/Y. pseudotuberculosis relationship

    • Reflects the different natural reservoirs of these species - Y. enterocolitica is associated primarily with pigs, while Y. pseudotuberculosis has a more diverse host range including livestock, pets, wild animals, and zoo animals

  • Comparison with other Enterobacteriaceae:

    • Functional conservation across the family, but with sequence variations

    • Different regulatory mechanisms controlling expression:

      • In Salmonella, the PmrA/PmrB and PhoP/PhoQ systems predominate

      • In Y. pseudotuberculosis, additional regulatory pathways may be involved

  • Structural and functional conservation:

    • Core transmembrane domains are highly conserved across species

    • Variable regions may reflect adaptation to specific membrane environments

    • The heterodimeric nature of the ArnE/F flippase complex appears to be conserved

  • Evolutionary significance:

    • The arn operon shows evidence of horizontal gene transfer in some species

    • Y. pseudotuberculosis has acquired various mobile genetic elements that likely originated from Enterobacteriaceae and other soil-dwelling bacteria that persist in the same ecological niche

    • These acquisition events have contributed to the unique gene pool of Y. pseudotuberculosis, potentially including variations in the arn operon

The comparison of ArnE across species provides insights into:

  • The evolution of antimicrobial resistance mechanisms

  • Adaptations to different host environments

  • The role of horizontal gene transfer in bacterial evolution

  • Potential targets for species-specific antimicrobial development

What role does ArnE play in the environmental persistence of Y. pseudotuberculosis?

ArnE plays a significant role in the environmental persistence of Y. pseudotuberculosis through several mechanisms related to stress resistance and adaptation to diverse ecological niches:

  • Contribution to antimicrobial peptide resistance:

    • Natural environments contain various antimicrobial peptides produced by competing microorganisms, plants, and animals

    • ArnE, as part of the Ara4N modification system, helps Y. pseudotuberculosis resist these natural antimicrobial compounds

    • This resistance enables survival in soil, water, and animal reservoirs where antimicrobial peptides are present

  • Adaptation to diverse host environments:

    • Y. pseudotuberculosis has a remarkably broad host range, infecting humans, livestock, pets, wild animals, and zoo animals

    • Different hosts produce varying antimicrobial peptides as part of their innate immune defenses

    • ArnE-mediated lipid A modification provides adaptability to these diverse host environments

  • Environmental stress protection:

    • Modification of lipid A can alter membrane properties beyond antimicrobial peptide resistance

    • These changes may contribute to resistance against:

      • pH fluctuations in soil and water

      • Temperature variations in different environments

      • Desiccation during dry periods

      • Osmotic stress in varying salinity conditions

  • Role in zoonotic transmission:

    • Y. pseudotuberculosis is often implicated in lethal epidemics in zoo animals

    • The broad host range of Y. pseudotuberculosis compared to Y. enterocolitica suggests enhanced adaptive capabilities

    • ArnE may contribute to the organism's ability to persist in environmental reservoirs and facilitate transmission between different animal species and humans

  • Seasonal and geographical distribution:

    • Y. pseudotuberculosis infections show seasonal patterns

    • Different strains circulate in different geographical regions

    • ArnE-mediated membrane modifications may contribute to adaptation to specific environmental conditions

Research approaches to study these aspects include:

  • Comparative survival studies of wild-type and arnE mutant strains in soil microcosms

  • Animal colonization models to assess transmission potential

  • Competition assays with environmental antimicrobial-producing microorganisms

  • Transcriptomic analysis of arnE expression under various environmental stressors

How can the study of ArnE contribute to the development of novel antimicrobial strategies?

The study of ArnE in Y. pseudotuberculosis has significant potential to contribute to novel antimicrobial strategies through several research applications:

  • Inhibitor development targeting the flippase complex:

    • ArnE/F as a novel drug target with several advantages:

      • Not present in human cells

      • Critical for polymyxin resistance

      • Membrane localization makes it accessible to drug binding

    • High-throughput screening approaches to identify small molecule inhibitors

    • Structure-based drug design once structural information is available

    • Combination therapy potential with existing polymyxin antibiotics

  • Polymyxin resensitization strategies:

    • Compounds that inhibit ArnE function could resensitize resistant bacteria to polymyxins

    • This approach could revitalize polymyxin antibiotics as effective treatments

    • Potential applications in multiple bacterial species that use the Ara4N pathway

  • Diagnostic applications:

    • Development of molecular diagnostics to detect antimicrobial resistance mechanisms

    • Identification of polymyxin resistance before treatment failure

    • Monitoring the spread of resistance determinants in clinical and environmental settings

  • Vaccine development considerations:

    • Understanding lipid A modifications can inform vaccine design

    • Modified lipid A structures affect immunogenicity and may be utilized in vaccine formulations

    • ArnE inhibition could alter bacterial immunogenicity during infection

  • Synthetic biology applications:

    • Engineering bacterial membrane properties through controlled expression of ArnE

    • Development of bacterial delivery systems with enhanced survival in harsh environments

    • Creation of engineered probiotics with improved colonization capabilities

  • One Health approaches:

    • Since Y. pseudotuberculosis infects a broad spectrum of animals including livestock, pets, wild animals, and zoo animals , targeting ArnE could have applications in veterinary medicine

    • Reduction of Y. pseudotuberculosis in animal reservoirs could decrease human exposure

    • Environmental persistence could be addressed through targeted interventions

Future research directions should include:

  • Structural determination of the ArnE/F complex

  • Development of high-throughput screening assays for inhibitor discovery

  • In vivo validation of targeted approaches in animal models

  • Assessment of resistance development to any new ArnE-targeting compounds

What experimental challenges exist in studying the ArnE/F flippase complex, and how might they be overcome?

Studying the ArnE/F flippase complex presents several significant experimental challenges due to its membrane localization, complex formation, and the difficulty in directly observing flippase activity. Below are the major challenges and potential methodological approaches to overcome them:

  • Membrane protein expression and purification challenges:

    • Challenge: Membrane proteins like ArnE are difficult to express at high levels and often aggregate during purification

    • Solutions:

      • Use of specialized expression systems (C41/C43 E. coli strains, cell-free systems)

      • Fusion partners to enhance solubility (MBP, SUMO)

      • Optimization of detergent selection for solubilization

      • Nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like membrane environments

  • Heterodimeric complex formation:

    • Challenge: ArnE functions with ArnF as a heterodimer, complicating expression and functional studies

    • Solutions:

      • Co-expression strategies with dual plasmids or bicistronic constructs

      • Sequential purification using different affinity tags on each subunit

      • Chemical cross-linking to stabilize complexes

      • Split-protein complementation assays to confirm interaction

  • Assaying flippase activity:

    • Challenge: Directly observing the translocation of lipid-linked substrates across membranes is technically difficult

    • Solutions:

      • Fluorescent bactoprenyl substrate analogs such as 2CN-BP

      • Liposome reconstitution with fluorescence quenching assays

      • Mass spectrometry-based detection of substrate translocation

      • Accessibility assays using membrane-impermeable reagents

  • Structural characterization:

    • Challenge: Membrane proteins are challenging targets for structural biology

    • Solutions:

      • Cryo-electron microscopy of purified complexes

      • X-ray crystallography with lipidic cubic phase crystallization

      • Nuclear magnetic resonance of isotopically labeled proteins

      • Computational modeling informed by evolutionary constraints

  • Substrate availability:

    • Challenge: Natural substrates like BP-Ara4N are difficult to obtain in sufficient quantities

    • Solutions:

      • Genetic approaches to accumulate intermediates, as demonstrated for BP-Ara4FN using an arnD deletion strain

      • Chemical synthesis of substrate analogs

      • Enzymatic synthesis using purified upstream enzymes

      • Development of simplified substrate mimics

  • Functional reconstitution:

    • Challenge: Recreating the native membrane environment and associated protein complexes

    • Solutions:

      • Proteoliposome reconstitution with defined lipid composition

      • Giant unilamellar vesicles for single-molecule studies

      • Supported lipid bilayers for surface-sensitive techniques

      • Cell-derived membrane vesicles maintaining native lipid composition

  • In vivo validation:

    • Challenge: Confirming that in vitro observations reflect physiological function

    • Solutions:

      • Complementation of arnE/arnF knockout strains with mutant variants

      • In vivo crosslinking to capture transient interactions

      • Conditional expression systems to control protein levels

      • Microscopy techniques to visualize protein localization and dynamics

A multi-faceted approach combining genetic, biochemical, and biophysical methods is likely to yield the most comprehensive understanding of the ArnE/F flippase complex and its role in antimicrobial resistance.

What regulatory considerations apply to research with recombinant Y. pseudotuberculosis expressing modified arnE constructs?

Research with recombinant Y. pseudotuberculosis expressing modified arnE constructs requires careful attention to several regulatory considerations to ensure compliance with institutional and national guidelines:

  • NIH Guidelines classification and approval requirements:

    • Work with recombinant Y. pseudotuberculosis typically falls under Section III-D of the NIH Guidelines, requiring IBC approval before initiation

    • The experiments must be reviewed for:

      • Appropriate containment level

      • Facilities adequacy

      • Procedures and practices

      • Personnel expertise and training

  • Risk assessment considerations:

    • Pathogenic potential:

      • Y. pseudotuberculosis is a human pathogen causing acute gastroenteritis and mesenteric lymphadenitis

      • It has a broad host range including humans, livestock, pets, wild animals, and zoo animals

    • Modified arnE impact:

      • Enhanced expression may increase antimicrobial resistance

      • Novel fusion proteins may alter bacterial properties

      • Knockout constructs may have attenuated virulence

  • Biosafety level requirements:

    • Y. pseudotuberculosis work is typically conducted at BSL-2

    • Modified strains with potentially enhanced resistance or virulence may require enhanced BSL-2 practices

    • A thorough risk assessment should determine if higher containment is needed

  • Documentation and approval process:

    • Principal Investigators must submit protocols to the IBC before initiation

    • The submission should include:

      • Detailed experimental design

      • Description of recombinant constructs

      • Risk assessment

      • Safety procedures and containment measures

      • Personnel training documentation

  • Institutional responsibilities:

    • Institutions must ensure that all recombinant DNA research, regardless of funding source, complies with NIH Guidelines

    • Non-compliance can result in:

      • Suspension, limitation, or termination of NIH funds for recombinant DNA research

      • Requirement for prior NIH approval of recombinant DNA projects

  • Emergency response planning:

    • Principal Investigators must adhere to IBC-approved emergency plans for:

      • Handling accidental spills

      • Personnel contamination

      • Potential releases

  • Reporting requirements:

    • Any new information bearing on the NIH Guidelines must be reported to the IBC and NIH/OBA

    • Significant research-related accidents and illnesses must be reported to appropriate authorities within 30 days

  • Transfer and shipping regulations:

    • Transfer of recombinant strains between institutions requires appropriate permits

    • Shipping must comply with Department of Transportation regulations for infectious substances

  • International considerations:

    • If research is conducted internationally:

      • Research must comply with host country rules if established

      • If the host country lacks rules, research must be reviewed by an NIH-approved IBC

      • Safety practices must be reasonably consistent with NIH Guidelines

Researchers working with recombinant Y. pseudotuberculosis must remain informed about current regulatory requirements and should consult with their institutional biosafety office early in the planning process.

What are the key knowledge gaps in our understanding of ArnE function in Y. pseudotuberculosis?

Despite significant advances in our understanding of the Ara4N modification pathway, several important knowledge gaps remain regarding ArnE function in Y. pseudotuberculosis:

  • Structural characterization:

    • The three-dimensional structure of ArnE alone or in complex with ArnF remains undetermined

    • The molecular mechanism of substrate recognition and translocation is poorly understood

    • The exact stoichiometry of the ArnE/F complex has not been definitively established

  • Functional mechanisms:

    • The energy source driving flippase activity (ATP-dependent or facilitated diffusion) is unknown

    • Whether ArnE/F functions exclusively as a flippase or has additional roles remains to be determined

    • The exact substrate specificity and potential for transporting molecules other than BP-Ara4N is unclear

  • Regulatory networks:

    • The complete set of environmental signals that regulate arnE expression in Y. pseudotuberculosis

    • Species-specific regulatory mechanisms compared to other pathogens

    • Post-translational regulation of ArnE function through protein-protein interactions or modifications

  • Physiological roles beyond antimicrobial resistance:

    • Potential roles in general membrane homeostasis

    • Contribution to environmental stress responses

    • Interaction with other membrane modification systems

  • Host-pathogen interactions:

    • How ArnE-mediated lipid A modifications affect recognition by host immune receptors

    • Impact on colonization and persistence in different host species

    • Role in the development of Far East scarlet-like fever (FESLF) symptoms

  • Evolutionary aspects:

    • The evolutionary origin of the arn operon in Yersinia species

    • Selection pressures driving conservation of ArnE across bacterial species

    • Reasons for the broad host range of Y. pseudotuberculosis compared to related species

  • Technological limitations:

    • Lack of high-throughput assays for flippase activity

    • Challenges in directly visualizing substrate translocation

    • Difficulty in purifying and manipulating membrane protein complexes

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, genetics, microbiology, and computational methods. A more complete understanding of ArnE function would significantly advance our knowledge of bacterial membrane biology and antimicrobial resistance mechanisms.

How might future technological advances enhance our ability to study ArnE and related membrane proteins?

Future technological advances hold great promise for enhancing our ability to study ArnE and related membrane proteins, potentially overcoming many of the current experimental limitations:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy improvements:

      • Higher resolution imaging of membrane protein complexes

      • Smaller protein size limits enabling study of proteins like ArnE

      • Time-resolved cryo-EM to capture different conformational states

    • Integrative structural biology approaches:

      • Combining multiple techniques (X-ray, NMR, SAXS, computational modeling)

      • Machine learning to predict structures from sequence and sparse experimental data

      • Single-particle diffraction with X-ray free electron lasers

  • Membrane mimetic systems:

    • Next-generation membrane mimetics:

      • Advanced nanodiscs with controlled size and composition

      • Biomimetic polymer-based membranes with controlled properties

      • 3D-printed artificial cell membranes with defined architecture

    • Cell-derived membrane systems:

      • Giant plasma membrane vesicles preserving native lipid organization

      • Extracted bacterial outer membrane vesicles for native environment studies

      • Hybrid systems combining synthetic and natural components

  • Advanced imaging technologies:

    • Super-resolution microscopy:

      • Single-molecule localization microscopy of labeled ArnE in live cells

      • Stimulated emission depletion (STED) microscopy for nanoscale resolution

      • Expansion microscopy to physically enlarge samples for improved visualization

    • Functional imaging:

      • Fluorescence resonance energy transfer (FRET) sensors for conformational changes

      • Fluorescent substrate analogs with improved properties

      • Label-free imaging methods to observe native proteins

  • Synthetic biology and protein engineering:

    • Designer membrane proteins:

      • Computational design of modified ArnE variants with enhanced properties

      • Biosensors based on ArnE to detect antimicrobial resistance

      • Split protein systems to control and monitor flippase activity

    • Minimal synthetic cells:

      • Bottom-up assembly of artificial cells with defined components

      • Reconstitution of the complete Ara4N modification pathway

      • Synthetic genetic circuits to control expression

  • Mass spectrometry innovations:

    • Native mass spectrometry:

      • Analysis of intact membrane protein complexes

      • Determination of binding partners and stoichiometry

      • Conformational dynamics monitoring

    • Sensitivity improvements:

      • Detection of low-abundance lipid intermediates

      • Single-cell lipidomics to monitor modifications

      • Spatial resolution through mass spectrometry imaging

  • Computational methods:

    • Enhanced molecular dynamics simulations:

      • Longer timescale simulations to capture complete translocation events

      • Machine learning-augmented force fields for more accurate modeling

      • Coarse-grained models for system-scale simulations

    • Artificial intelligence applications:

      • Prediction of protein-protein interactions in membrane environments

      • Design of specific inhibitors targeting ArnE

      • Automated analysis of high-throughput experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.