Recombinant Yersinia pseudotuberculosis serotype O:3 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Yersinia pseudotuberculosis serotype O:3 ArnF is a 128-amino acid protein (UniProt ID: B1JJ34) expressed in E. coli with an N-terminal His tag . It belongs to the undecaprenyl phosphate-aminoarabinose (L-Ara4N) flippase family, critical for modifying lipid A in bacterial lipopolysaccharides (LPS) to confer resistance to cationic antimicrobial peptides and polymyxins .

Biological Function

ArnF partners with ArnE to form a flippase complex that transports undecaprenyl phosphate-α-L-Ara4N across the inner membrane. This modification of lipid A is essential for:

  • Antimicrobial resistance: Reduces LPS net negative charge, limiting cationic peptide binding .

  • Virulence regulation: Critical in Yersinia pathogenesis and host immune evasion .

Production Protocols

  • Cloning: Full-length arnF gene cloned into E. coli vectors .

  • Purification: Affinity chromatography via His-tag, followed by lyophilization .

  • Yield: 0.1–1.0 mg/mL after reconstitution .

Research Applications

  • Mechanistic studies: Used to dissect lipid A modification pathways .

  • Vaccine development: Engineered Yersinia strains expressing modified lipid A (e.g., MPLA) show enhanced immunogenicity in plague vaccine candidates .

  • Antimicrobial resistance screening: Target for novel polymyxin adjuvants .

Comparative Analysis with Homologs

SpeciesUniProt IDLength (aa)Key Differences
Escherichia coli APEC O1A1ADB012878% sequence identity; lower pLDDT (79.85)
Salmonella typhiQ8Z537125Truncated C-terminal; 72% identity

Related Research Findings

  • Genetic knockout studies: ΔarnF mutants in Y. pseudotuberculosis exhibit increased susceptibility to polymyxin B .

  • Structural insights: Molecular dynamics simulations reveal conformational changes during substrate binding .

  • Vaccine adjuvants: Recombinant Y. pseudotuberculosis strains producing MPLA-enriched OMVs induce robust immune responses against Y. pestis .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; YPK_1837; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
arnF
Target Protein Sequence
MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYFVQLASVMCGLMGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATLLKTLGAGFILLGIWLI NIKPIKAS
Uniprot No.

Target Background

Function
This protein functions as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: ypy:YPK_1837

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.