Recombinant Yersinia pseudotuberculosis serotype O:3 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt in Gram-Negative Bacteria

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme critical for lipoprotein biosynthesis in Gram-negative bacteria. It catalyzes the first step: transferring a diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins . This modification anchors lipoproteins to the membrane, enabling their roles in nutrient uptake, virulence, and outer membrane (OM) integrity .

Functional Role of Lgt in Yersinia pseudotuberculosis

In Y. pseudotuberculosis serotype O:3, Lgt is essential for:

  • Membrane integrity: Depletion disrupts OM stability, increasing susceptibility to serum killing and antibiotics .

  • Virulence: Lipoproteins are critical for host-pathogen interactions; Lgt activity indirectly supports bacterial survival in hostile host environments .

  • Resistance evasion: Unlike downstream lipoprotein biosynthesis steps (e.g., LspA or LolCDE), Lgt inhibition is not rescued by deleting the major OM lipoprotein lpp, suggesting unique therapeutic potential .

Table 1: Key Features of Lgt Across Bacterial Species

FeatureY. pseudotuberculosis (Inferred)E. coli (Experimental Data)
Catalytic activityDiacylglyceryl transferDiacylglyceryl transfer
Membrane topology7 transmembrane domains7 transmembrane domains
Essential residuesY26, N146, G154 (predicted)Y26, N146, G154, R143, E151
Role in OM integrityCriticalValidated via genetic depletion

Table 2: Critical Residues for Lgt Activity

ResidueRole in CatalysisExperimental Evidence (from E. coli)
Y26Stabilizes substrate bindingAlanine substitution abolishes activity
N146Participates in acyl transferRequired for enzymatic function
G154Maintains structural flexibilityMutation disrupts membrane localization

Implications for Antibacterial Therapy

  • Target validation: Lgt is a novel druggable target due to its essential role and resistance mechanism evasion .

  • Cross-species relevance: Inhibitors effective against E. coli and A. baumannii may extend to Y. pseudotuberculosis given structural conservation .

  • Vaccine development: Modulating lipoprotein biosynthesis (via Lgt) could enhance outer membrane vesicle (OMV) production for vaccines, as demonstrated in engineered Y. pseudotuberculosis strains .

Data Gaps and Future Directions

  • Structural studies: No crystal structure exists for Y. pseudotuberculosis Lgt; homology modeling based on E. coli is needed.

  • In vivo efficacy: Testing Lgt inhibitors in Yersinia infection models is critical for therapeutic validation.

  • Mechanistic overlap: Investigate whether Yersinia Lgt interacts with host immune components (e.g., CD209 receptors) during dissemination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; YPK_1035; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAMLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS
Uniprot No.

Target Background

Function

Recombinant Yersinia pseudotuberculosis serotype O:3 Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: ypy:YPK_1035

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in bacterial lipoprotein biosynthesis that catalyzes the attachment of a diacylglycerol moiety, particularly phosphatidylglycerol, to the thiol group of the conserved +1 position cysteine via a thioester bond in bacterial preprolipoproteins. This enzyme serves as the committing step in lipoprotein modification, essentially initiating the lipoprotein maturation pathway necessary for bacterial membrane integrity and function . In Y. pseudotuberculosis serotype O:3, lgt (UniProt: B1JQC9) is expressed as a transmembrane protein with critical importance for bacterial pathogenicity and survival . The enzyme's function is essential for proper lipoprotein localization and anchoring to the bacterial membrane, which ultimately affects multiple physiological processes including nutrient acquisition, stress response, and host-pathogen interactions.

How is recombinant Y. pseudotuberculosis lgt typically produced for research applications?

Recombinant Y. pseudotuberculosis serotype O:3 lgt protein is typically produced using an in vitro E. coli expression system . The commercially available recombinant protein (e.g., product code CSB-CF541834YAX) is designed with an N-terminal 10xHis-tag to facilitate purification through affinity chromatography . The expression construct includes the full-length protein (regions 1-290), which contains all the functional domains necessary for enzymatic activity . For optimal protein quality, the recombinant protein must be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended. Working aliquots should be stored at 4°C for no more than one week, and repeated freezing and thawing should be avoided to maintain protein stability and activity .

What are the optimal conditions for studying lgt enzymatic activity in vitro?

For studying the enzymatic activity of Y. pseudotuberculosis lgt in vitro, researchers should consider several critical parameters based on known properties of bacterial lgt enzymes. Although recombinant Lgt has shown activity in aqueous environments, the optimal experimental conditions should mimic the membrane environment where the enzyme naturally functions . A typical reaction setup would include:

ParameterRecommended ConditionRationale
Buffer composition50 mM Tris-HCl, pH 7.5, 150 mM NaClMaintains physiological pH and ionic strength
Membrane mimetics0.1-0.5% Triton X-100 or DDMProvides lipid-like environment for transmembrane protein
Divalent cations5-10 mM MgCl₂Facilitates enzymatic reaction
Reducing agent1-2 mM DTTMaintains thiol groups in reduced state
Temperature30-37°COptimal for bacterial enzyme activity
SubstrateSynthetic preprolipoprotein peptidesContains conserved lipobox motif
Phospholipid sourcePhosphatidylglycerolPreferred substrate for diacylglycerol transfer

Experimental readouts typically involve monitoring the transfer of the diacylglyceryl moiety from phospholipids to the substrate peptide, which can be tracked using radiolabeled phospholipids, fluorescent lipid analogs, or mass spectrometry-based approaches. The recognition of the signal peptide alone has been shown to be sufficient for the reaction to occur, which allows for simplified substrate design in activity assays .

How can researchers verify the proper folding and functionality of purified recombinant lgt?

Verifying proper folding and functionality of purified recombinant Y. pseudotuberculosis lgt requires multiple complementary approaches:

  • Size Exclusion Chromatography (SEC): Assess protein monodispersity and oligomeric state. Well-folded transmembrane proteins typically elute as defined peaks.

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure content. Given the predicted five transmembrane helices, properly folded lgt should show a high α-helical content with characteristic minima at 208 and 222 nm.

  • Thermal Shift Assay: Evaluate protein stability by determining the melting temperature. Properly folded transmembrane proteins typically show cooperative unfolding transitions.

  • Enzymatic Activity Assay: The gold-standard verification is demonstrating enzymatic function by measuring the transfer of diacylglycerol to a substrate peptide containing the conserved lipobox motif. This can be monitored through:

    • Thin-layer chromatography (TLC) separation of lipidated products

    • Mass spectrometry detection of modified peptides

    • Fluorescence-based assays with labeled substrates

  • Western Blot Analysis: For His-tagged recombinant lgt, verification of the intact protein can be performed using anti-His antibodies to confirm the expected molecular weight of approximately 32-33 kDa (protein) plus the tag contribution .

What considerations are important for storage and handling of recombinant lgt protein?

Proper storage and handling of recombinant Y. pseudotuberculosis lgt is critical for maintaining its stability and activity:

  • Temperature: Store stock solutions at -20°C or -80°C for extended storage periods. According to product specifications, the shelf life of liquid form is generally 6 months at -20°C/-80°C, while lyophilized forms can be stable for up to 12 months at the same temperatures .

  • Working Aliquots: Store at 4°C for no more than one week to minimize protein degradation. Repeated freezing and thawing should be strictly avoided as it significantly reduces protein stability and activity .

  • Buffer Composition: The storage buffer should contain stabilizing agents such as glycerol (10-20%) and possibly low concentrations of detergents to maintain the transmembrane protein in solution. The specific buffer composition should be optimized based on downstream applications.

  • Handling Precautions: Minimize exposure to proteases by using clean laboratory equipment and working efficiently at appropriate temperatures. Consider adding protease inhibitors when working with the protein for extended periods.

  • Quality Control: Periodically verify protein integrity through SDS-PAGE and functional assays, especially after extended storage periods or when transitioning between storage conditions.

How does Y. pseudotuberculosis lgt contribute to bacterial pathogenesis and host-pathogen interactions?

Y. pseudotuberculosis is a Gram-negative enteropathogen that causes gastrointestinal infections and can disseminate from the gut to mesenteric lymph nodes, spleen, and liver . The lgt enzyme plays a critical role in this pathogenesis through multiple mechanisms:

  • Lipoprotein Maturation: By catalyzing the first step in lipoprotein processing, lgt ensures proper localization and function of numerous bacterial lipoproteins involved in virulence, adhesion, and immune evasion.

  • Membrane Integrity: Properly processed lipoproteins contribute to outer membrane stability, which is essential for bacterial survival within host environments and resistance to host defense mechanisms.

  • Immunomodulation: Bacterial lipoproteins are potent activators of innate immunity through Toll-like receptor 2 (TLR2) recognition. The lipid moiety transferred by lgt is crucial for this recognition, suggesting that lgt activity influences the immunostimulatory properties of Y. pseudotuberculosis.

  • CD209 Receptor Interactions: Although not directly mediated by lgt itself, Y. pseudotuberculosis utilizes its lipopolysaccharide (LPS) core to interact with CD209 receptors, leading to invasion of human dendritic cells and murine macrophages . The proper display of membrane components, which depends partly on lipoprotein processing, may influence these interactions.

  • Dissemination Mechanisms: Research has shown that Y. pseudotuberculosis can disseminate to mesenteric lymph nodes, spleens, and livers of both wild-type and Peyer's patch-deficient mice . The proper processing of lipoproteins by lgt likely contributes to this dissemination capability.

What structural features distinguish lgt from Y. pseudotuberculosis from other bacterial species?

While the core function of lgt is conserved across bacterial species, several features distinguish the Y. pseudotuberculosis serotype O:3 lgt from its homologs:

  • Sequence Variations: The Y. pseudotuberculosis lgt (UniProt: B1JQC9) shows species-specific sequence adaptations while maintaining highly conserved catalytic residues. These variations likely contribute to subtle differences in substrate specificity or regulatory mechanisms.

  • Membrane Topology: Although the predicted five-transmembrane helix structure is common among bacterial lgt proteins, species-specific variations in the length and composition of connecting loops may influence interaction with other membrane components or substrate recognition patterns.

  • Catalytic Efficiency: The enzymatic properties of Y. pseudotuberculosis lgt may be optimized for its specific cellular environment, including membrane composition and preferred growth temperature. These adaptations would be reflected in kinetic parameters such as Km and kcat values.

  • Environmental Response: As a pathogen that transitions between environmental reservoirs and mammalian hosts, Y. pseudotuberculosis lgt may exhibit adaptive responses to changing conditions (temperature, pH, nutrient availability) that differ from those of non-pathogenic bacteria.

  • Integration with Virulence Systems: In Y. pseudotuberculosis, lgt function may be coordinated with specialized secretion systems and virulence factors that are not present in non-pathogenic species, potentially leading to unique regulatory interactions.

Comparative analyses of lgt proteins across different Yersinia species and other enteropathogens would provide valuable insights into these distinguishing features and their potential implications for pathogenesis and host-specific adaptations.

How can recombinant lgt be used in the development of novel antibacterial strategies?

Recombinant Y. pseudotuberculosis lgt offers several potential applications for developing novel antibacterial strategies:

  • Target-Based Drug Discovery: As an essential enzyme for bacterial viability with no mammalian homolog, lgt represents an attractive target for antibacterial drug development. Recombinant protein can be used in high-throughput screening assays to identify inhibitors that could serve as leads for novel antibiotics.

  • Structure-Based Drug Design: Although complete structural information is limited, recombinant lgt could be used for crystallography or cryo-EM studies to determine its three-dimensional structure, facilitating rational design of inhibitors targeting the active site or regulatory domains.

  • Vaccine Development: As demonstrated with other Y. pseudotuberculosis proteins, engineered bacterial strains can deliver antigens and stimulate protective immunity . Recombinant lgt or lgt-derived peptides could potentially serve as vaccine components, especially if they contain conserved epitopes across pathogenic Yersinia species.

  • Diagnostic Applications: Antibodies raised against recombinant lgt could be used to develop diagnostic tests for Y. pseudotuberculosis infections, complementing current serological approaches that require up to 42 days for results .

  • Bacterial Physiology Studies: Using recombinant lgt as a tool to understand lipoprotein processing pathways could reveal new insights into bacterial membrane organization and biogenesis, potentially identifying additional targets for intervention.

  • Immunomodulatory Applications: Since bacterial lipoproteins are potent stimulators of innate immunity, engineered lgt variants with altered substrate specificity could potentially be used to create custom lipoproteins with designed immunomodulatory properties.

What are common challenges in expressing and purifying functional recombinant lgt?

Researchers working with recombinant Y. pseudotuberculosis lgt often encounter several challenges:

  • Low Expression Yields: As a transmembrane protein, lgt can be toxic to expression hosts when overexpressed, leading to growth inhibition and low yields. Strategies to address this include:

    • Using tightly controlled inducible promoters

    • Lower induction temperatures (16-25°C)

    • Specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Codon optimization for the expression host

  • Protein Misfolding and Aggregation: The hydrophobic nature of transmembrane helices in lgt predisposes it to aggregation and inclusion body formation. Approaches to mitigate this include:

    • Addition of mild detergents during cell lysis

    • Inclusion of chemical chaperones in growth media

    • Fusion to solubility-enhancing tags

    • Refolding protocols specific for membrane proteins

  • Purification Difficulties: Extracting and purifying membrane proteins while maintaining their native conformation requires specialized techniques:

    • Careful selection of detergents that maintain protein stability and activity

    • Gradient purification schemes that gradually transition between detergent types

    • Size exclusion chromatography as a final polishing step

    • Quality control at each purification stage

  • Activity Loss During Purification: The enzymatic activity of lgt depends on proper folding and membrane environment. Strategies to preserve activity include:

    • Inclusion of lipids or lipid-like molecules during purification

    • Maintaining reducing conditions to protect catalytic cysteine residues

    • Minimizing exposure to extreme pH or ionic conditions

    • Rapid processing and appropriate storage conditions

  • Detergent Interference with Activity Assays: Detergents necessary for lgt solubilization may interfere with downstream activity assays. This requires:

    • Careful selection of compatible detergents

    • Development of assay formats that accommodate or account for detergent effects

    • Potential reconstitution into liposomes or nanodiscs for activity measurements

How can researchers study the interaction of lgt with its substrate preprolipoproteins?

Studying the interaction between lgt and its preprolipoprotein substrates requires specialized approaches:

  • Peptide-Based Binding Assays: Synthetic peptides containing the conserved lipobox motif can be used to study binding interactions through:

    • Fluorescence polarization with labeled peptides

    • Surface plasmon resonance (SPR) with immobilized enzyme or substrate

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

  • Cross-Linking Studies: Chemical cross-linking combined with mass spectrometry can identify interaction interfaces between lgt and its substrates:

    • Photo-activatable cross-linkers incorporated into synthetic substrates

    • Analysis of cross-linked peptides to map binding sites

    • Validation of interactions through mutagenesis of identified residues

  • Computational Approaches: In silico docking and molecular dynamics simulations can predict:

    • Binding modes of substrates to lgt

    • Conformational changes associated with substrate recognition

    • Effects of mutations on binding affinity and specificity

  • Activity-Based Protein Profiling: Using substrate analogs with reactive groups to capture enzyme-substrate complexes:

    • Development of activity-based probes that mimic natural substrates

    • Identification of catalytically important residues through differential labeling

    • Visualization of enzyme activity in complex mixtures

  • Reconstituted Systems: Incorporating purified lgt into artificial membrane systems:

    • Proteoliposomes with defined lipid composition

    • Nanodiscs for single-molecule studies

    • Cell-free expression systems for coupled transcription-translation-modification studies

What approaches can identify potential inhibitors of Y. pseudotuberculosis lgt activity?

Several complementary approaches can be employed to identify potential inhibitors of Y. pseudotuberculosis lgt:

  • High-Throughput Screening (HTS): Using recombinant lgt in biochemical assays to screen compound libraries:

    • Fluorescence-based assays monitoring lipid transfer to peptide substrates

    • Assays measuring phospholipid consumption or product formation

    • Counterscreening against mammalian enzymes to establish selectivity

  • Fragment-Based Drug Discovery: Identifying small chemical fragments that bind to lgt:

    • Nuclear magnetic resonance (NMR) screening

    • Thermal shift assays to identify stabilizing compounds

    • X-ray crystallography to determine binding modes

  • Virtual Screening: Computational approaches to identify potential inhibitors:

    • Structure-based virtual screening against homology models

    • Pharmacophore-based screening based on substrate requirements

    • Molecular dynamics simulations to identify transient binding pockets

  • Phenotypic Screening: Cell-based approaches to identify compounds with activity against Y. pseudotuberculosis:

    • Bacterial growth inhibition assays

    • Reporter systems that monitor lipoprotein processing

    • Validation of mechanism through biochemical assays with recombinant lgt

  • Natural Product Screening: Testing extracts from diverse sources:

    • Plant extracts with traditional antimicrobial uses

    • Microbial secondary metabolites, especially from soil bacteria

    • Marine organisms and extremophiles as sources of novel chemotypes

Screening ApproachAdvantagesLimitationsFollow-up Validation
Biochemical HTSDirect measurement of enzyme inhibitionMay not predict cellular activityCellular activity, selectivity testing
Fragment-BasedIdentifies efficiently binding chemotypesLow initial potencyFragment growing, linking, merging
Virtual ScreeningCost-effective, large librariesDepends on model qualityBiochemical confirmation of hits
PhenotypicIdentifies cell-active compoundsMechanism may be unclearTarget engagement studies
Natural ProductsNovel chemical scaffoldsComplex mixturesBioassay-guided fractionation

How might structural studies of Y. pseudotuberculosis lgt advance our understanding of bacterial lipoprotein processing?

Despite the functional importance of lgt in bacterial physiology, detailed structural information remains limited . Future research focused on solving the three-dimensional structure of Y. pseudotuberculosis lgt would provide several important advances:

  • Catalytic Mechanism: A high-resolution structure would reveal the precise arrangement of active site residues and help elucidate the catalytic mechanism of diacylglycerol transfer to substrate cysteine residues. This would build upon current knowledge that identifies several critical residues, including a conserved histidine (equivalent to His103 in E. coli), Tyr235, and His196 .

  • Substrate Recognition: Structural studies would clarify how lgt recognizes the lipobox motif in preprolipoprotein substrates, potentially revealing specific binding pockets or interaction surfaces that determine substrate specificity.

  • Membrane Integration: Understanding how the five predicted transmembrane helices are arranged within the lipid bilayer would provide insights into how lgt accesses both its phospholipid and protein substrates simultaneously.

  • Species-Specific Features: Comparing structures of lgt from Y. pseudotuberculosis with homologs from other bacterial species would highlight conserved features essential for function as well as species-specific adaptations.

  • Rational Drug Design: A detailed structure would facilitate structure-based drug design efforts to develop selective inhibitors of bacterial lgt enzymes as potential novel antibiotics.

Technical approaches for structural determination might include X-ray crystallography of detergent-solubilized protein, cryo-electron microscopy, or NMR studies of specific domains, potentially complemented by computational modeling approaches.

What roles might Y. pseudotuberculosis lgt play in bacterial adaptation to host environments?

As Y. pseudotuberculosis transitions from environmental reservoirs to mammalian hosts during infection, it encounters dramatically different conditions that require adaptive responses. Future research could explore how lgt function contributes to these adaptations:

  • Temperature-Responsive Activity: Investigating whether lgt activity changes in response to temperature shifts (from environmental temperatures to 37°C in mammalian hosts) could reveal regulatory mechanisms that optimize lipoprotein processing during infection.

  • pH and Stress Adaptation: Examining lgt function under various stress conditions encountered during infection (acidic environment, antimicrobial peptides, nutrient limitation) could identify how lipoprotein processing contributes to bacterial resilience.

  • Tissue-Specific Regulation: Y. pseudotuberculosis disseminates from the gut to multiple organs including mesenteric lymph nodes, spleen, and liver . Research could explore whether lgt activity or substrate specificity varies across these different host niches.

  • Immune Evasion Strategies: Since bacterial lipoproteins are recognized by the host immune system, particularly through TLR2, future studies might investigate whether modulation of lgt activity affects immune recognition and evasion strategies.

  • Comparative Analysis Across Yersinia Species: Comparing lgt function in Y. pseudotuberculosis with homologs in related species like Y. pestis and Y. enterocolitica could reveal how lipoprotein processing contributes to the distinct pathogenic strategies of these bacteria.

  • Interaction with Host-Specific Factors: Investigating whether host molecules directly or indirectly influence lgt activity could uncover novel aspects of host-pathogen interactions at the molecular level.

How can systems biology approaches advance our understanding of lgt function in bacterial physiology?

Integrating lgt research into broader systems biology frameworks offers promising avenues for understanding its role in the complex network of bacterial cellular processes:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.