Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
mdtI; YPK_2130; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
mdtI
Target Protein Sequence
MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links

KEGG: ypy:YPK_2130

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are most effective for producing recombinant MdtI protein?

    For optimal expression of recombinant MdtI:

    • Use E. coli expression systems (BL21(DE3) or C41/C43 strains specialized for membrane proteins)

    • Employ vectors with inducible promoters (T7 or tac) for controlled expression

    • Include affinity tags (His-tag preferred) at the N-terminus for purification

    • Culture at lower temperatures (16-25°C) after induction to improve proper folding

    • Consider codon optimization for the E. coli host

    Purification typically involves membrane fraction isolation followed by solubilization with mild detergents (DDM or LDAO) and immobilized metal affinity chromatography. The purified protein is often stabilized in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

  • How does the MdtJI complex protect bacteria from polyamine toxicity?

    Experiments with E. coli have demonstrated that the MdtJI complex protects cells from toxic accumulation of spermidine through several mechanisms:

    1. Direct export of excess intracellular spermidine

    2. Expression of mdtJI mRNA is upregulated in response to elevated spermidine levels

    3. Cells expressing functional MdtJI show significantly reduced intracellular spermidine concentrations when grown in spermidine-rich media

    In experimental systems using spermidine acetyltransferase-deficient strains, expression of both MdtJ and MdtI was necessary to rescue cells from growth inhibition caused by spermidine toxicity. This suggests a similar protective role in Y. pseudotuberculosis .

Advanced Research Questions

  • Which specific amino acid residues in MdtI are critical for spermidine export function, and how can they be studied?

    Based on site-directed mutagenesis studies in the E. coli homolog, several key residues have been identified as essential for MdtI function:

    ResiduePositionProposed FunctionExperimental Effect of Mutation
    Glu5Substrate binding/recognitionSevere loss of transport activity
    Glu19Proton couplingReduced transport activity
    Asp60Ion coordinationSevere loss of transport activity
    Trp68Membrane interaction/stabilityComplete loss of function
    Trp81Substrate interactionSevere loss of transport activity

    Methodological approach for structure-function studies:

    1. Generate site-directed mutants using PCR-based mutagenesis

    2. Express mutant proteins and verify expression levels by Western blotting

    3. Assess functional impact through complementation assays in spermidine-sensitive strains

    4. Measure direct transport activity using radiolabeled [14C]spermidine

    5. Evaluate protein stability and membrane insertion using protease accessibility assays

  • What methodological approaches can quantify MdtI-mediated spermidine export in Y. pseudotuberculosis?

    A comprehensive experimental protocol for assessing MdtI-mediated spermidine export includes:

    1. Genetic manipulation:

      • Generate mdtI knockout, mdtJI double knockout, and complemented strains

      • Create strains expressing tagged versions for localization studies

    2. Transport activity measurement:

      • Preload cells with [14C]spermidine, then measure efflux rates

      • Quantify intracellular vs. extracellular labeled spermidine

      • Analyze spermidine content by HPLC or LC-MS/MS after cellular extraction

    3. Functional complementation:

      • Transform spermidine acetyltransferase-deficient cells with plasmids expressing MdtI and MdtJ

      • Assess growth recovery in medium containing toxic spermidine concentrations (2mM)

      • Measure spermidine content in cells and culture supernatant

    4. Expression analysis:

      • Quantify mdtJI mRNA levels in response to spermidine exposure using qRT-PCR

      • Monitor protein expression with tagged constructs or specific antibodies

  • How do resistance determinants like MdtI contribute to the emergence of multidrug-resistant Y. pseudotuberculosis strains?

    While MdtI primarily functions as a spermidine exporter, its membership in the SMR family suggests potential roles in broader resistance mechanisms:

    1. Contribution to intrinsic resistance:

      • MdtI may provide baseline protection against certain antimicrobial compounds with structural similarities to polyamines

      • The protein could function in stress responses that indirectly promote survival during antibiotic exposure

    2. Association with mobile genetic elements:

      • Y. pseudotuberculosis has demonstrated ability to acquire conjugative multidrug resistance plasmids (IncN and IncHI2 groups)

      • These plasmids can carry resistance determinants for 4-6 classes of antibiotics

      • Research should investigate whether mdtI variants are present on these mobile elements

    3. Experimental approaches:

      • Compare mdtI expression levels in susceptible vs. resistant isolates

      • Generate knockout strains to assess changes in MIC values for various antibiotics

      • Perform transcriptomic analysis in the presence of subinhibitory antibiotic concentrations

  • What is the significance of transmembrane domain organization in MdtI function, and how can it be investigated?

    The transmembrane organization of MdtI is critical for its function as part of the MdtJI spermidine exporter:

    1. Structural prediction methods:

      • Use algorithms such as TMHMM, HMMTOP, and Phobius to predict transmembrane helices

      • Apply homology modeling based on crystallized SMR family proteins

      • Perform molecular dynamics simulations to study conformational changes during transport

    2. Experimental validation approaches:

      • Cysteine scanning mutagenesis with accessibility assays

      • Site-directed spin labeling combined with EPR spectroscopy

      • Membrane topology mapping using reporter fusions (PhoA/LacZ)

      • Cross-linking studies to identify interaction surfaces between MdtJ and MdtI

    3. Functional correlation:

      • Systematically mutate residues in each predicted transmembrane domain

      • Correlate structural alterations with changes in transport efficiency

      • Investigate helix-helix interactions using in vivo and in vitro approaches

  • How do experimental design limitations affect studies of MdtI in Y. pseudotuberculosis, and what are potential solutions?

    Research on MdtI faces several experimental challenges that require careful methodological consideration:

    1. Membrane protein expression issues:

      • Low expression yields and improper folding

      • Solution: Use specialized expression strains (C41/C43), lower induction temperatures, and fusion partners to enhance solubility and folding

    2. Functional redundancy:

      • Y. pseudotuberculosis may have multiple polyamine transporters with overlapping functions

      • Solution: Generate multiple knockout strains and employ combinatorial approaches to reveal phenotypes

    3. Assay sensitivity limitations:

      • Low transport rates may be difficult to detect

      • Solution: Develop more sensitive detection methods using fluorescent polyamine analogs or targeted metabolomics

    4. In vivo relevance:

      • Laboratory conditions may not reflect the pathogen's environment during infection

      • Solution: Design experiments that mimic host conditions (nutrient limitation, pH shifts, presence of host factors)

  • What role might MdtI play in colonization and virulence of Y. pseudotuberculosis?

    Polyamine homeostasis is increasingly recognized as important for bacterial pathogenesis:

    1. Potential roles in virulence:

      • Regulation of biofilm formation

      • Resistance to host antimicrobial peptides

      • Adaptation to host-imposed stress conditions

      • Modulation of toxin production or secretion

    2. Experimental approaches:

      • Infection assays using wild-type and ΔmdtI mutants in cell culture models

      • Animal infection models to assess colonization efficiency and virulence

      • Transcriptomic analysis of mdtI expression during different stages of infection

      • Competition assays between wild-type and mutant strains in mixed infections

    3. Correlation with virulence factors:

      • Investigate relationships between MdtI function and known virulence determinants

      • Examine mdtI expression in hypervirulent strains like those associated with Far East Scarlet-Like Fever

  • How can recombinant MdtI be utilized in vaccine development strategies against Y. pseudotuberculosis?

    Recent advances in vaccine development suggest potential applications for MdtI:

    1. Outer membrane vesicle (OMV) vaccine platforms:

      • MdtI as a potential antigen in OMV-based vaccines

      • Experimental approach: Engineer Y. pseudotuberculosis strains to overexpress MdtI in OMVs

      • Assess immunogenicity and protective efficacy in animal models

    2. Methodological considerations:

      • Generate recombinant strains expressing modified MdtI with enhanced immunogenicity

      • Implement lipid A modifications to reduce reactogenicity while maintaining adjuvant properties

      • Develop strategies to increase OMV production through mutations in genes like tolR

      • Evaluate protection against different serotypes and related Yersinia species

    3. Safety and efficacy testing:

      • Measure antibody responses using ELISA and neutralization assays

      • Assess T-cell responses through cytokine profiling and proliferation assays

      • Challenge studies to determine protective efficacy against different routes of infection

  • How can contradictory experimental data regarding MdtI function be interpreted and reconciled?

    When facing inconsistent results in MdtI research:

    1. Systematically evaluate experimental variables:

      • Strain background differences (laboratory vs. clinical isolates)

      • Growth conditions affecting expression (media composition, growth phase)

      • Assay-specific limitations (sensitivity, specificity)

    2. Implement robust experimental designs:

      • Include appropriate positive and negative controls

      • Use multiple complementary assays to measure the same parameter

      • Perform side-by-side comparisons of different strains under identical conditions

      • Apply statistical approaches appropriate for the experimental design

    3. Resolution strategies:

      • Develop unified experimental protocols that can be standardized across laboratories

      • Establish agreed-upon reference strains for comparative studies

      • Employ systems biology approaches to place MdtI function in broader cellular context

      • Conduct meta-analyses of published data to identify consistent patterns

  • What are the current gaps in understanding the regulatory network controlling MdtI expression in Y. pseudotuberculosis?

    Several aspects of MdtI regulation remain to be elucidated:

    1. Transcriptional regulation:

      • Promoter architecture and regulatory elements

      • Transcription factors controlling expression

      • Environmental signals affecting transcription

    2. Experimental approaches:

      • Promoter mapping using 5' RACE and primer extension

      • Reporter gene fusions to identify regulatory regions

      • ChIP-seq to identify transcription factor binding sites

      • RNA-seq under various conditions to identify co-regulated genes

    3. Post-transcriptional regulation:

      • mRNA stability determinants

      • Small RNA regulators

      • Translational efficiency factors

    4. Post-translational regulation:

      • Protein stability and turnover

      • Potential modifications affecting activity

      • Regulation of complex formation with MdtJ

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.