Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Yersinia pseudotuberculosis

Yersinia pseudotuberculosis is a Gram-negative foodborne pathogen that causes a variety of gastrointestinal symptoms in humans, including fever, abdominal pain, and diarrhea. This bacterium is part of the enteropathogenic Yersinia species, which also includes Y. enterocolitica and the more notorious Y. pestis, the causative agent of plague. Y. pseudotuberculosis infections typically result from consuming contaminated food or water, with the bacteria subsequently crossing the intestinal barrier and establishing infection in lymphatic tissues.

Pathogenesis and Virulence Mechanisms

Y. pseudotuberculosis employs multiple virulence strategies to establish infection within its host. The bacterium initially crosses the intestinal barrier through specialized M cells in the small intestine, a process facilitated by adhesins like invasin . Upon crossing this barrier, Y. pseudotuberculosis encounters the host immune response in Peyer's patches. To counter this response, the pathogen deploys a Type 3 Secretion System (T3SS), a sophisticated molecular "syringe" that injects cytotoxic effector proteins, known as Yersinia outer proteins (Yops), directly into host cells .

These effector proteins disrupt host cell defense mechanisms and cytoskeletal integrity, hampering the ability of phagocytes to engulf the bacteria. The T3SS apparatus spans the bacterial membrane and requires at least 25 proteins, collectively termed Ysc (Yersinia secretion) proteins, for its assembly and function . The injected Yops can be categorized as translocators (YopB, YopD, and LcrV), effectors (including YopE, YopH, and several others), and regulators (YopK/YopQ and YopE) .

Significance of Serotype O:3

Yersinia pseudotuberculosis serotype O:3 (strain YPIII) has clinical and epidemiological importance as one of the predominant serotypes associated with human infections. The serotype classification is based on the O-antigen, a component of the lipopolysaccharide in the bacterial outer membrane. Serotype O:3 has been implicated in numerous outbreaks and demonstrates distinct virulence characteristics that contribute to its pathogenicity.

Spermidine and Bacterial Physiology

Spermidine is a polyamine that plays essential roles in numerous cellular processes in bacteria, including cell growth, proliferation, and stress response. Polyamines like spermidine can interact with nucleic acids, stabilize membranes, and protect cells against various environmental stresses. The regulation of polyamine concentrations within bacterial cells is critical for optimal functioning.

MdtJ Function in Polyamine Transport

As its name suggests, MdtJ functions as a spermidine export protein, facilitating the transport of spermidine across the bacterial membrane. Export proteins like MdtJ are essential for maintaining appropriate intracellular concentrations of polyamines, preventing toxic accumulation while ensuring sufficient levels for cellular processes.

The MdtJ protein likely forms part of a multidrug transport system, which may explain the "Mdt" (multidrug transport) designation in its name. In many bacteria, such transport systems contribute to resistance against antimicrobial compounds and environmental stresses.

Comparative Analysis with Related Proteins

While the search results contain limited information on direct comparisons, it's worth noting that similar spermidine export proteins exist in other bacterial species. For instance, search result mentions a related protein in Salmonella dublin, suggesting conservation of this protein function across various Gram-negative pathogens . This conservation implies evolutionary importance for bacterial survival and potential roles in pathogenesis.

Potential Contributions to Bacterial Stress Response

While the search results don't explicitly connect MdtJ to Y. pseudotuberculosis pathogenesis, we can analyze the potential relationship based on known bacterial physiology. Polyamine transport systems, including spermidine exporters like MdtJ, often play crucial roles in bacterial adaptation to environmental stresses. Y. pseudotuberculosis encounters numerous stressors during infection, including pH changes, oxidative stress, and nutrient limitation.

The CpxA-CpxR two-component regulatory system mentioned in search result is one example of how Y. pseudotuberculosis responds to extracytoplasmic stress (ECS). This system regulates factors that maintain envelope integrity while also modulating virulence determinants . It's possible that MdtJ could intersect with such regulatory networks, contributing to bacterial adaptation during infection.

Connection to Bacterial Survival in Host Environments

Search result emphasizes that Y. pseudotuberculosis survival within macrophages is crucial for virulence . Though not directly linked to MdtJ in the search results, membrane transporters often play vital roles in intracellular survival by mediating the export of host antimicrobial compounds or regulating the bacterial response to intracellular stresses.

Production and Availability

Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtJ is commercially available for research purposes. According to search result , it is supplied in quantities of 50 μg (with other quantities available upon request) and is produced as a recombinant protein with a tag that is determined during the production process .

Applications in Research

Recombinant MdtJ has various potential applications in research, including:

  1. Structural and functional studies of membrane transporters

  2. Investigation of bacterial stress response mechanisms

  3. Development of antibodies against Y. pseudotuberculosis proteins

  4. Screening for inhibitors that could serve as potential therapeutic agents

ELISA-Based Detection

Enzyme-Linked Immunosorbent Assay (ELISA) techniques are available for the detection and quantification of MdtJ protein. Search result specifically mentions ELISA Recombinant Yersinia pseudotuberculosis serotype O:3 Spermidine export protein MdtJ, indicating the availability of immunological detection methods for this protein .

Comparative Analysis with SmpB-SsrA System Research Methods

While the search results don't directly link MdtJ to the SmpB-SsrA system, the methodologies used to study this system in Y. pseudotuberculosis (as described in search result ) provide valuable approaches that could be applied to MdtJ research. These include:

  1. Survival assays in macrophage cell lines to assess bacterial fitness

  2. Host cell cytotoxicity assays to evaluate effects on virulence

  3. Western blot analysis to examine protein expression levels

  4. Quantitative real-time PCR to measure gene expression

  5. Northern blot analysis to assess mRNA stability and turnover

These techniques could be adapted to investigate the potential role of MdtJ in bacterial pathogenesis and stress response.

Limited Knowledge Base

One of the significant challenges in researching MdtJ is the relatively limited information specifically focused on this protein in Y. pseudotuberculosis. Current knowledge gaps include:

  1. Precise structural details of the protein's membrane topology

  2. Regulatory mechanisms controlling mdtJ expression

  3. Interaction partners within the bacterial membrane

  4. Specific contribution to virulence and pathogenesis

Potential Research Directions

Future research on MdtJ could pursue several promising directions:

  1. Structural characterization using techniques like cryo-electron microscopy

  2. Gene knockout studies to assess the impact on bacterial fitness and virulence

  3. Transcriptomic and proteomic analyses to identify conditions affecting mdtJ expression

  4. Screening for small molecule inhibitors as potential antimicrobial agents

  5. Investigation of potential interactions with host defense mechanisms

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences in the order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
mdtJ; YPK_2131; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links

KEGG: ypy:YPK_2131

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ and what is its primary function in Yersinia pseudotuberculosis?

MdtJ is a membrane protein that functions as part of a spermidine excretion complex (MdtJI) in bacteria. Based on studies in Escherichia coli, MdtJ belongs to the small multidrug resistance (SMR) family of drug exporters and works in conjunction with MdtI to form a functional complex that catalyzes the excretion of spermidine from bacterial cells . In Y. pseudotuberculosis, MdtJ is believed to serve a similar function, helping to regulate intracellular polyamine levels, particularly spermidine, which can become toxic at high concentrations. This export mechanism represents an important cellular detoxification pathway that contributes to bacterial survival under conditions of polyamine stress.

How does the MdtJI complex contribute to bacterial survival?

The MdtJI complex plays a critical role in maintaining polyamine homeostasis, particularly by preventing the toxic accumulation of spermidine. Research in E. coli has demonstrated that cells deficient in spermidine acetyltransferase (which normally metabolizes excess spermidine) show significantly improved growth and reduced toxicity when transformed with plasmids encoding both MdtJ and MdtI . This protective effect occurs through the enhanced excretion of spermidine from cells, effectively lowering intracellular concentrations to non-toxic levels. In the context of Y. pseudotuberculosis pathogenesis, this mechanism may be particularly important during infection, when bacteria encounter varying polyamine concentrations in host tissues.

What is the genetic organization of mdtJ in Y. pseudotuberculosis?

In Y. pseudotuberculosis, mdtJ typically exists in an operon with mdtI, similar to the arrangement observed in E. coli. The genes are co-transcribed, and their expression appears to be regulated in response to spermidine levels, with increased mdtJI mRNA production occurring when spermidine concentrations rise . This coordinated expression is consistent with the functional requirement for both proteins to form the active export complex. Understanding this genetic organization is essential for designing experiments to study MdtJ function through genetic manipulation techniques.

What are the recommended approaches for studying MdtJ function in Y. pseudotuberculosis?

Several experimental approaches can be employed to investigate MdtJ function:

Genetic knockouts and complementation studies:

  • Create mdtJ deletion mutants in Y. pseudotuberculosis

  • Assess phenotypic changes in spermidine tolerance

  • Complement mutants with plasmid-expressed mdtJ (similar to pUCmdtJI or pMWmdtJI systems used in E. coli studies)

  • Measure growth rates in the presence of varying spermidine concentrations

Spermidine transport assays:

  • Quantify intracellular spermidine content in wild-type versus mdtJ-mutant strains

  • Measure spermidine excretion rates using radiolabeled spermidine

  • Compare spermidine accumulation in cells cultured with external spermidine (e.g., 2mM concentration as used in E. coli studies)

Expression analysis:

  • Monitor mdtJI mRNA levels in response to polyamine stress using qRT-PCR

  • Analyze protein expression levels under various growth conditions

In vivo infection models:

  • Compare colonization and virulence of wild-type versus mdtJ-mutant strains in mouse models similar to those used for other Y. pseudotuberculosis virulence studies

How can recombinant MdtJ be expressed and purified for structural studies?

Expression and purification of MdtJ present challenges typical of membrane proteins:

Expression systems:

  • Use E. coli BL21(DE3) with T7 promoter-based expression vectors

  • Consider specialized strains optimized for membrane protein expression

  • Employ fusion tags (His6, MBP, or SUMO) to enhance solubility and facilitate purification

Induction conditions:

  • Lower induction temperatures (16-20°C)

  • Reduced IPTG concentrations (0.1-0.5 mM)

  • Extended expression periods (16-24 hours)

Membrane extraction and purification:

  • Solubilize membranes using mild detergents (DDM, LDAO, or C12E8)

  • Purify via immobilized metal affinity chromatography (IMAC)

  • Consider size exclusion chromatography as a polishing step

  • Maintain detergent above critical micelle concentration throughout purification

Verification:

  • Confirm identity via mass spectrometry

  • Assess purity by SDS-PAGE

  • Verify function through reconstitution in proteoliposomes

What techniques are most effective for analyzing the structure-function relationship of MdtJ?

Several approaches can elucidate structure-function relationships:

Site-directed mutagenesis:

  • Target key residues identified in E. coli MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82)

  • Create alanine-scanning libraries across transmembrane domains

  • Evaluate mutant phenotypes for spermidine transport efficiency

Structural biology techniques:

  • X-ray crystallography of purified MdtJI complex

  • Cryo-electron microscopy for membrane protein structure determination

  • Molecular dynamics simulations to predict conformational changes during transport

Functional assays:

  • Reconstitute purified wild-type and mutant proteins in liposomes

  • Measure spermidine transport using fluorescence-based assays

  • Assess oligomerization state using crosslinking and analytical ultracentrifugation

Comparative analysis:

  • Align MdtJ sequences from multiple bacterial species

  • Identify conserved residues as potential functional hotspots

  • Map conservation data onto predicted structural models

How does MdtJ contribute to antibiotic tolerance mechanisms in Y. pseudotuberculosis?

While direct evidence linking MdtJ to antibiotic tolerance in Y. pseudotuberculosis is limited, several potential mechanisms warrant investigation:

Polyamine-mediated stress response:

  • Polyamines like spermidine have been implicated in stress responses that confer antibiotic tolerance

  • MdtJ may indirectly modulate these responses by controlling intracellular polyamine levels

Membrane permeability regulation:

  • The export of charged polyamines may affect membrane potential or permeability

  • Y. pseudotuberculosis demonstrates altered membrane permeability as part of its doxycycline tolerance strategy, as evidenced by differential regulation of porins like OmpF

  • MdtJ could potentially interact with or affect these permeability pathways

Connection to translation machinery:

  • Y. pseudotuberculosis modulates tRNA modifications (via tusB) as part of its antibiotic tolerance mechanism

  • Polyamines interact with RNA and ribosomes, suggesting potential crosstalk between MdtJ-mediated polyamine export and translational machinery

Experimental approach for testing these hypotheses:

  • Compare antibiotic minimal inhibitory concentrations (MICs) between wild-type and mdtJ-mutant strains

  • Assess survival during prolonged antibiotic exposure (tolerance assays)

  • Examine transcriptional responses to antibiotics in the presence/absence of functional MdtJ

What is the significance of amino acid residues identified in MdtJ for spermidine export function?

The E. coli MdtJ protein contains several critical amino acid residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) involved in spermidine export activity . These residues likely fulfill specific functions:

ResidueProbable FunctionExperimental Evidence
Tyr4, Tyr45, Tyr61Aromatic interactions with spermidineMutation reduces export activity
Trp5Membrane positioning and substrate bindingEssential for functional activity
Glu15, Glu82Ionic interactions with positively charged spermidineCharge neutralization abolishes function

The distribution of these residues within the transmembrane domains likely creates a channel or pathway that facilitates spermidine movement across the membrane. In Y. pseudotuberculosis MdtJ, homologous residues would be expected to serve similar functions, though specific confirmation through mutagenesis studies would be required.

How does the MdtJI complex interact with other cellular systems during Y. pseudotuberculosis infection?

The MdtJI complex likely engages with multiple cellular systems during infection:

Polyamine metabolic networks:

  • Interplay with polyamine biosynthesis enzymes (e.g., ornithine decarboxylase, S-adenosylmethionine decarboxylase)

  • Coordination with polyamine degradation pathways (e.g., spermidine acetyltransferase)

  • Potential regulatory feedback loops governing polyamine homeostasis

Stress response systems:

  • Connection to general stress response pathways activated during host infection

  • Possible links to antibiotic tolerance mechanisms, such as those involving tRNA modifications

Virulence regulation:

  • Potential crosstalk with virulence factors, such as the Yersinia cytotoxic necrotizing factor (CNFY)

  • Possible influence on pathogenicity island expression

Investigating these interactions would require systems biology approaches, including:

  • Transcriptomic analysis comparing wild-type and mdtJ-mutant strains during infection

  • Metabolomic profiling of polyamine pathways

  • Protein-protein interaction studies to identify MdtJ/MdtI binding partners

How does MdtJ in Y. pseudotuberculosis compare to homologs in other bacterial pathogens?

MdtJ belongs to the widely distributed small multidrug resistance (SMR) family of transporters. Comparative analysis reveals:

Sequence conservation:

  • High conservation of key functional residues (Tyr, Trp, Glu) across diverse bacterial species

  • Variable regions that may confer species-specific substrate preferences

Genomic context:

  • Consistent operon arrangement with mdtI across Enterobacteriaceae

  • Variable genomic neighborhoods in more distant bacterial relatives

Functional adaptation:

  • Potential specialization for different polyamine substrates in different bacterial species

  • Varying importance to pathogenesis depending on infection niche

Research approaches should include:

  • Phylogenetic analysis of MdtJ sequences across bacterial pathogens

  • Complementation studies testing if MdtJ proteins from other species can function in Y. pseudotuberculosis

  • Investigation of selective pressures on mdtJ genes in different bacterial lineages

What is the evolutionary significance of spermidine export systems in bacterial pathogens?

Spermidine export via MdtJ represents an important adaptation that may confer several evolutionary advantages:

Host-pathogen interactions:

  • Mammalian tissues contain varying levels of polyamines that bacteria must adapt to

  • Regulation of intracellular polyamine levels may help pathogens optimize growth in different host environments

Stress tolerance:

  • Polyamine export systems may contribute to survival under various stresses encountered during infection

  • Y. pseudotuberculosis employs multiple stress response mechanisms during infection and antibiotic exposure

Metabolic adaptation:

  • Control of polyamine pools allows for metabolic flexibility during infection

  • May interact with other adaptive mechanisms, such as tRNA modifications that promote survival during antibiotic exposure

Research in this area should examine:

  • Distribution and conservation of MdtJ across bacterial pathogens with different host ranges

  • Regulation of mdtJ expression in different infection models

  • Competitive fitness of mdtJ mutants during in vivo infection

What are the most promising approaches for investigating MdtJ's role in Y. pseudotuberculosis pathogenesis?

Several high-priority research directions emerge:

In vivo infection studies:

  • Analyze colonization and persistence of mdtJ mutants in mouse models

  • Examine tissue-specific requirements for MdtJ function

  • Use approaches similar to those employed for studying Y. pseudotuberculosis doxycycline tolerance

Polyamine dynamics during infection:

  • Map spermidine concentrations encountered by Y. pseudotuberculosis in different host tissues

  • Determine how MdtJ contributes to adaptation to these varying conditions

  • Investigate potential metabolic cross-feeding involving polyamines during infection

Integration with virulence mechanisms:

  • Examine potential connections between MdtJ-mediated polyamine export and known virulence factors

  • Investigate whether MdtJ affects expression of pathogenicity factors similar to the observed regulation of CNFY and other factors during antibiotic exposure

Therapeutic targeting:

  • Develop small molecule inhibitors of the MdtJI complex

  • Evaluate their potential to sensitize Y. pseudotuberculosis to existing antibiotics

  • Assess specificity across different bacterial pathogens

How might advances in structural biology contribute to understanding MdtJ function?

Recent advances in structural biology techniques promise new insights:

Cryo-electron microscopy:

  • Determination of MdtJI complex structure in membrane environment

  • Visualization of conformational changes during spermidine transport

  • Identification of potential drug binding sites

Integrative structural approaches:

  • Combining crystallography, NMR, mass spectrometry, and computational modeling

  • Mapping transport pathways through the MdtJI complex

  • Understanding the molecular basis for substrate selectivity

In situ structural studies:

  • Visualization of MdtJ within bacterial membranes using advanced microscopy

  • Determination of oligomeric state and interactions in native environment

  • Tracking conformational dynamics during transport cycles

These approaches could provide critical insights for:

  • Rational design of inhibitors targeting the MdtJI complex

  • Engineering bacterial strains with modified polyamine transport characteristics

  • Understanding fundamental mechanisms of SMR transporters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.