Recombinant Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

What is the molecular structure and function of Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ?

The Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a membrane protein that functions as part of the sulfoxide reductase system. This protein consists of 206 amino acids with a molecular structure characterized by transmembrane domains that anchor it to the bacterial membrane. The complete amino acid sequence is: MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLLVSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTLGIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIAYAVMAALLLLLRYKLLLPRYKKFRQWFR .

YedZ functions primarily as a heme-binding component of the sulfoxide reductase system, which is involved in the reduction of methionine sulfoxides. This system plays a critical role in protecting bacteria against oxidative stress by repairing oxidized methionine residues in proteins, similar to how methionine sulfoxide reductases function in other organisms .

How does YedZ compare to methionine sulfoxide reductases in other organisms?

• While yeast MsrA specifically reduces Met-S-SO and MsrB reduces Met-R-SO, YedZ functions as a heme-binding subunit within a larger sulfoxide reductase complex .

• The enzymatic mechanism differs: Yeast Msr enzymes utilize a redox mechanism involving cysteine residues and require DTT or thioredoxin as reducing agents, whereas YedZ, as a heme-binding protein, likely participates in electron transfer through its heme group .

• Msr enzymes in yeast have been extensively studied for their roles in oxidative stress resistance and lifespan regulation, with experimental evidence showing that MsrA overexpression can increase yeast lifespan under aerobic conditions .

• Unlike the soluble Msr enzymes, YedZ is membrane-bound, suggesting different cellular localization and potentially distinct biological roles specific to bacterial physiology .

The comparison demonstrates evolutionary conservation of sulfoxide reductase function across species while highlighting specialized adaptations in different organisms.

What experimental methods are recommended for initial characterization of YedZ activity?

For initial characterization of YedZ activity, researchers should consider the following methodological approach based on established protocols for sulfoxide reductases:

• HPLC-based activity assay: Adapt the dabsylated methionine sulfoxide reduction assay described for MsrA and MsrB enzymes. This method allows quantitative measurement of methionine sulfoxide reduction to methionine . Reaction mixtures should contain purified YedZ (5 μg), methionine sulfoxide substrates (25-400 μM), and appropriate electron donors.

• Spectrophotometric heme analysis: Since YedZ is a heme-binding protein, UV-visible spectroscopy can be used to characterize the heme environment and its redox states.

• Membrane fraction preparation: As YedZ is membrane-bound, proper extraction using glass beads followed by sonication is crucial for activity measurements .

• Controls and validation: Include parallel assays with known methionine sulfoxide reductases (MsrA and MsrB) and substrate specificity tests using both Met-S-SO and Met-R-SO stereoisomers .

Remember that optimal reaction conditions may need adjustment for YedZ specifically, as conditions established for yeast Msr enzymes (37°C, pH 7.5, 20 mM DTT) may not be optimal for the Yersinia pseudotuberculosis protein .

How can researchers effectively design experiments to study YedZ's role in Yersinia pseudotuberculosis virulence and pathogenicity?

Designing experiments to investigate YedZ's role in Yersinia pseudotuberculosis virulence requires a multifaceted approach:

• Gene knockout and complementation studies: Generate YedZ deletion mutants (ΔyedZ) and complemented strains. Compare virulence phenotypes including:

  • Survival under oxidative stress conditions

  • Ability to colonize experimental animal models

  • Expression of downstream virulence factors

• Transcriptomics and proteomics analysis: Compare gene expression and protein profiles between wild-type and ΔyedZ mutants under different conditions, particularly focusing on known virulence-associated pathways.

• Interaction with host immune defenses: Examine the susceptibility of ΔyedZ mutants to neutrophil killing, macrophage phagocytosis, and reactive oxygen species.

• Serotype-specific effects: Since different serotypes of Y. pseudotuberculosis show variable virulence properties, test the impact of YedZ deletion across multiple serotypes including O:1a, O:1b, O:2a, O:2b, and O:3 .

• Evaluation in context of virulence factors: Assess how YedZ activity correlates with the presence of major virulence determinants such as the virulence plasmid pYV and the high-pathogenicity island (HPI) .

This experimental design allows for comprehensive evaluation of YedZ's contribution to pathogenicity while controlling for strain-specific variations in virulence potential.

What are the optimal conditions for expressing and purifying functional recombinant YedZ protein?

For optimal expression and purification of functional recombinant YedZ protein, researchers should consider the following protocol based on established methodologies for membrane proteins and heme-binding proteins:

• Expression system selection:

  • Recommended: E. coli BL21(DE3) with specialized vectors containing inducible promoters (T7 or tac)

  • Alternative: Yeast expression systems may provide better membrane protein folding

• Construct design:

  • Include a cleavable affinity tag (His6 or Strep-tag) at either N- or C-terminus

  • Avoid disrupting predicted transmembrane domains

  • Consider adding a signal sequence for proper membrane insertion

• Culture conditions:

  • Lower induction temperature (16-20°C) to promote proper folding

  • Supplement with δ-aminolevulinic acid (0.5 mM) as a heme precursor

  • Use terrific broth with glycerol (0.4%) for better membrane protein expression

• Membrane protein extraction:

  • Gentle cell lysis using spheroplasting or osmotic shock methods

  • Solubilization with mild detergents (DDM, LMNG, or Cymal-5 at 1%)

  • Include protease inhibitors and reducing agents

• Purification strategy:

  • Immobilized metal affinity chromatography (IMAC) as first step

  • Size exclusion chromatography for final polishing

  • Maintain detergent above critical micelle concentration throughout

• Functional validation:

  • UV-visible spectroscopy to confirm heme incorporation

  • HPLC-based activity assays adapted from those used for methionine sulfoxide reductases

This methodological approach maximizes the likelihood of obtaining functionally active YedZ protein suitable for downstream biochemical and structural studies.

How can researchers effectively analyze the role of YedZ in oxidative stress response pathways?

To effectively analyze YedZ's role in oxidative stress response pathways, researchers should implement a comprehensive experimental strategy:

• Comparative phenotypic analysis:

  • Create gene deletion (ΔyedZ) and overexpression strains

  • Measure survival rates under various oxidative stressors (H₂O₂, paraquat, NO donors)

  • Compare growth kinetics and lag phases after oxidative challenge

  • Evaluate membrane integrity using fluorescent dyes after oxidative stress

• Molecular mechanism investigation:

  • Measure cellular levels of oxidized proteins via oxyblot analysis

  • Quantify methionine sulfoxide content in cellular proteins using HPLC methods similar to those employed for methionine sulfoxide reductase activity

  • Assess redox status using fluorescent redox-sensitive probes

• Genetic interaction network:

  • Perform double knockout studies with other oxidative stress genes

  • Create an epistasis map with known oxidative stress response regulators

  • Conduct suppressor screens to identify genetic interactions

• Integration with global response pathways:

  • Analyze transcriptional changes using RNA-seq comparing WT and ΔyedZ strains

  • Perform ChIP-seq to identify regulators controlling yedZ expression

  • Use metabolomics to detect changes in redox-sensitive metabolites

• Cross-species complementation:

  • Test whether yeast methionine sulfoxide reductases can complement YedZ function in Yersinia pseudotuberculosis

  • Compare the protective effects against oxidative stress observed in yeast MsrA/MsrB systems with those of bacterial YedZ

This multifaceted approach will provide comprehensive insights into YedZ's specific contributions to oxidative stress resistance in Yersinia pseudotuberculosis.

What controls should be included when studying YedZ function in different environmental conditions?

When designing experiments to study YedZ function across environmental conditions, the following controls are essential:

• Genetic controls:

  • Wild-type strain (positive control)

  • YedZ deletion mutant (ΔyedZ)

  • Complemented strain (ΔyedZ + plasmid-expressed YedZ)

  • Catalytically inactive YedZ mutant (point mutation in heme-binding site)

• Enzymatic activity controls:

  • Purified MsrA and MsrB enzymes as comparative standards

  • Stereospecific methionine sulfoxide substrates (Met-S-SO and Met-R-SO)

  • Non-substrate analogs to verify specificity

  • Reactions without reducing agents or electron donors

• Environmental condition controls:

  • Aerobic vs. anaerobic conditions (similar to approaches used in yeast Msr studies)

  • pH gradient series (5.5-8.0)

  • Temperature range relevant to host and environmental niches

  • Nutrient limitation conditions (iron, carbon sources)

• Stress response controls:

  • Known oxidative stress-sensitive mutants (e.g., catalase or superoxide dismutase mutants)

  • Antioxidant-supplemented cultures

  • Defined concentrations of oxidative stressors (H₂O₂, superoxide, NO donors)

• Technical controls:

  • Multiple biological replicates (minimum n=3)

  • Technical replicates for each assay

  • Time-course measurements to capture dynamic responses

  • Instrument calibration standards

This comprehensive control strategy enables robust interpretation of results and helps distinguish YedZ-specific effects from general stress responses or technical artifacts.

How can researchers resolve contradictory data regarding YedZ function across different experimental systems?

When faced with contradictory data regarding YedZ function across experimental systems, researchers should implement the following systematic approach to resolve discrepancies:

• Standardization of experimental conditions:

  • Create a standardized protocol for YedZ activity assays

  • Ensure consistent protein preparation methods across laboratories

  • Establish reference standards for activity measurements

  • Develop detailed SOPs for critical experiments

• Cross-validation using multiple methodologies:

  • Apply orthogonal techniques to measure the same parameter

  • For example, assess oxidative stress resistance using:

    • Growth inhibition assays

    • Direct measurement of ROS

    • Protein carbonylation analysis

    • Transcriptional reporter assays

• Meta-analysis of experimental variables:

  • Create a comprehensive table documenting all experimental conditions:

• Collaborative cross-laboratory validation:

  • Exchange materials (strains, plasmids, antibodies)

  • Conduct parallel experiments in different laboratories

  • Blind analysis of key data sets

• Integration with comparative genomics:

  • Analyze YedZ homologs across related bacterial species

  • Compare results with similar systems like yeast MsrA/MsrB

  • Evaluate evolutionary conservation of functionally critical residues

• Statistical and methodological consultation:

  • Apply appropriate statistical tests for small sample sizes

  • Consider Bayesian approaches to integrate prior knowledge

  • Evaluate experimental power through simulation

This systematic approach enables identification of variables responsible for contradictory results and development of a unified model of YedZ function.

How can structural biology approaches enhance our understanding of YedZ function in Yersinia pseudotuberculosis?

Structural biology approaches can significantly enhance our understanding of YedZ function through the following methodological strategies:

• Membrane protein crystallography:

  • Utilize lipidic cubic phase (LCP) crystallization methods

  • Screen detergent conditions to maintain native conformation

  • Consider fusion protein approaches (T4 lysozyme or BRIL) to increase crystallizability

  • Focus on resolving the heme-binding pocket architecture

• Cryo-electron microscopy (cryo-EM):

  • Apply single-particle analysis for high-resolution structure determination

  • Use nanodiscs or amphipols to maintain membrane environment

  • Capture different functional states through substrate analogs or inhibitors

  • Visualize YedZ in complex with interacting partners

• NMR spectroscopy for dynamics:

  • Focus on methyl-TROSY approaches for large membrane proteins

  • Investigate conformational changes upon substrate binding

  • Characterize heme environment using paramagnetic NMR techniques

  • Map protein-protein interaction interfaces

• Computational approaches:

  • Perform molecular dynamics simulations in membrane environments

  • Use homology modeling based on related sulfoxide reductases

  • Apply quantum mechanics/molecular mechanics (QM/MM) to study the reaction mechanism

  • Predict substrate binding sites and selectivity determinants

• Integrative structural biology:

  • Combine low-resolution techniques (SAXS, HDX-MS) with high-resolution methods

  • Validate structural models using site-directed mutagenesis

  • Compare with structures of homologous proteins from different organisms

  • Create structure-based hypotheses for functional testing

• Structure-function correlation:

  • Design mutations based on structural data to test mechanistic hypotheses

  • Analyze conservation patterns in the context of the structural model

  • Investigate how serotype differences impact structure and function

  • Compare with yeast methionine sulfoxide reductase structures to identify functional parallels

This multifaceted structural biology approach would provide crucial insights into YedZ's catalytic mechanism, substrate specificity, and potential as a therapeutic target.

What is the relationship between YedZ function and pathogenicity in different Yersinia pseudotuberculosis serotypes?

The relationship between YedZ function and pathogenicity across Yersinia pseudotuberculosis serotypes represents a complex interplay that can be analyzed through the following integrated approach:

• Comparative genomics and expression analysis:

  • Sequence YedZ across different Y. pseudotuberculosis serotypes (O:1a, O:1b, O:2a, O:2b, O:3, O:13)

  • Compare expression levels in various serotypes under infection-relevant conditions

  • Correlate sequence variations with virulence profiles

• Virulence factor correlation:

  • Analyze how YedZ function relates to known virulence determinants:

    • Presence of virulence plasmid pYV (found in all serotypes)

    • Presence of high-pathogenicity island (HPI) (found in O:1a, O:1b, O:13, but not in O:2a, O:2b)

    • Other mobile genetic elements that vary between serotypes

• Functional comparison across serotypes:

  • Create a comparative table of YedZ properties and pathogenicity markers:

• Cross-complementation studies:

  • Exchange YedZ alleles between serotypes to assess function

  • Determine if YedZ from highly virulent serotypes enhances virulence of less pathogenic strains

  • Test whether YedZ function depends on serotype-specific genetic backgrounds

• Host-pathogen interaction studies:

  • Compare oxidative burst survival mediated by YedZ across serotypes

  • Analyze YedZ contribution to persistence in different host tissues

  • Evaluate serotype-specific responses to host-generated oxidative stress

• Evolutionary context:

  • Analyze selective pressure on YedZ across different serotypes

  • Investigate horizontal gene transfer patterns influencing YedZ function

  • Compare with related species to understand evolutionary trajectory

This integrated analysis would clarify whether YedZ represents a conserved virulence mechanism across serotypes or if its function has diverged to accommodate serotype-specific pathogenicity strategies.

What are the most effective approaches for studying YedZ interactions with other cellular components?

For studying YedZ interactions with other cellular components, researchers should employ these methodological approaches:

• In vivo crosslinking coupled with mass spectrometry:

  • Use membrane-permeable crosslinkers (DSP, formaldehyde)

  • Apply photo-activatable amino acids for site-specific crosslinking

  • Perform immunoprecipitation followed by LC-MS/MS

  • Analyze results using specialized interaction proteomics software

• Bacterial two-hybrid systems adapted for membrane proteins:

  • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system

  • Split-ubiquitin membrane yeast two-hybrid system

  • Create systematic screening libraries of potential interaction partners

  • Validate interactions with co-immunoprecipitation

• Proximity-based labeling approaches:

  • Express YedZ fused to BioID or TurboID

  • Allow in vivo biotinylation of proximal proteins

  • Purify biotinylated proteins using streptavidin affinity

  • Identify interaction partners through mass spectrometry

• Fluorescence-based interaction techniques:

  • Förster Resonance Energy Transfer (FRET) with fluorescent protein fusions

  • Bimolecular Fluorescence Complementation (BiFC)

  • Fluorescence Correlation Spectroscopy (FCS) for dynamic interactions

  • Single-molecule tracking to observe complex formation in live cells

• Functional genetics approaches:

  • Synthetic genetic array (SGA) analysis

  • Suppressor mutant screening

  • Genetic interaction mapping through double knockout libraries

  • Epistasis analysis with related oxidative stress response pathways

• Biochemical validation techniques:

  • Surface Plasmon Resonance (SPR) with purified components

  • Isothermal Titration Calorimetry (ITC) for binding affinity determination

  • Analytical ultracentrifugation for complex formation analysis

  • Native gel electrophoresis to preserve protein complexes

These complementary approaches provide a comprehensive framework for identifying and characterizing YedZ interactions, from initial discovery through detailed biochemical characterization and functional validation.

How can researchers effectively compare YedZ function to methionine sulfoxide reductases in eukaryotic systems?

To effectively compare YedZ function with eukaryotic methionine sulfoxide reductases, researchers should implement the following methodological strategy:

• Parallel enzyme activity assays:

  • Use identical substrates (dabsylated methionine sulfoxides) for both systems

  • Standardize reaction conditions to allow direct comparison

  • Test both Met-S-SO and Met-R-SO stereoisomers to determine specificity

  • Compare kinetic parameters (Km, Vmax, kcat) under varying conditions

• Heterologous expression studies:

  • Express YedZ in yeast systems with MsrA/MsrB knockouts

  • Express eukaryotic Msr enzymes in Yersinia pseudotuberculosis ΔyedZ strains

  • Measure complementation of oxidative stress phenotypes

  • Analyze protein-protein interaction patterns in the heterologous systems

• Comparative structural analysis:

  • Align structures or structural models of YedZ with MsrA/MsrB

  • Compare active site architectures and catalytic mechanisms

  • Analyze differences in cofactor requirements and electron transfer pathways

  • Design chimeric proteins to test domain-specific functions

• Oxidative stress response comparison:

  • Design parallel experiments in yeast and bacterial systems:

    • Use identical oxidative stressors (H₂O₂, paraquat)

    • Apply similar stress levels adjusted for each organism

    • Measure comparable endpoints (survival, protein oxidation)

  • Test the effects of caloric restriction in both systems, as this condition affects MsrA/MsrB function in yeast

• Evolutionary analysis:

  • Conduct phylogenetic analysis of sulfoxide reductase families

  • Identify conserved and divergent functional motifs

  • Analyze selective pressure on different domains

  • Trace the evolutionary history of these systems

• Comparative table of key properties:

This comprehensive comparison would elucidate the evolutionary relationships between these systems and potentially identify conserved mechanisms of oxidative stress protection that span prokaryotic and eukaryotic domains.

What emerging technologies could advance our understanding of YedZ function in bacterial physiology?

Several emerging technologies hold promise for advancing our understanding of YedZ function in bacterial physiology:

• CRISPR interference (CRISPRi) for temporal control:

  • Implement tunable repression of yedZ expression

  • Create depletion strains for essential contexts

  • Apply dCas9-based transcriptional modulators for precise regulation

  • Study effects of controlled YedZ levels on cellular physiology

• Single-cell technologies:

  • Apply microfluidics for single-cell analysis of YedZ function

  • Use time-lapse microscopy with fluorescent reporters to track real-time responses

  • Implement single-cell RNA-seq to capture cell-to-cell variability in YedZ-dependent responses

  • Develop biosensors for detecting sulfoxide reductase activity in vivo

• Advanced protein engineering approaches:

  • Apply directed evolution to modify YedZ substrate specificity

  • Develop split reporters based on YedZ for interaction studies

  • Create optogenetic versions of YedZ for light-controlled activity

  • Design biosensors based on YedZ conformational changes

• In situ structural biology:

  • Implement cryo-electron tomography to visualize YedZ in native membrane environments

  • Apply correlative light and electron microscopy (CLEM) to localize YedZ function

  • Use super-resolution microscopy to track YedZ dynamics during stress responses

  • Develop methods for in-cell NMR to study YedZ structural changes

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Apply machine learning to identify patterns in YedZ-dependent responses

  • Develop computational models of YedZ's role in redox homeostasis

  • Create predictive frameworks for YedZ function across different conditions

• Microbiome and ecological approaches:

  • Study YedZ function in polymicrobial communities

  • Analyze how YedZ contributes to survival in environmental niches

  • Investigate competitive advantages conferred by YedZ in mixed populations

  • Examine horizontal gene transfer patterns related to yedZ and associated genes

These emerging technologies would provide unprecedented insights into YedZ's dynamic functions in bacterial physiology and potentially reveal novel targets for antimicrobial development.

How might understanding YedZ function contribute to novel antimicrobial development strategies?

Understanding YedZ function could contribute to novel antimicrobial development through several strategic pathways:

• Target-based drug discovery:

  • Design inhibitors targeting the unique features of the YedZ heme-binding pocket

  • Develop compounds that disrupt electron transfer in the sulfoxide reductase system

  • Create covalent modifiers specific to critical YedZ residues

  • Screen compound libraries against purified YedZ protein

• Virulence attenuation strategies:

  • Target YedZ to reduce bacterial survival during oxidative burst

  • Develop anti-virulence compounds that inhibit YedZ without affecting growth

  • Create combination therapies targeting YedZ and complementary oxidative stress defense systems

  • Design drugs that increase bacterial susceptibility to host immune defenses

• Serotype-specific targeting:

  • Exploit structural differences in YedZ across pathogenic Yersinia serotypes

  • Develop narrow-spectrum antimicrobials with reduced resistance potential

  • Target serotype-specific interaction networks involving YedZ

  • Create diagnostics to identify susceptible strains based on YedZ sequence variants

• Host-directed therapeutics:

  • Enhance host oxidative burst mechanisms that overwhelm YedZ capacity

  • Modulate host immune responses to target YedZ-dependent processes

  • Develop peptide mimetics that interfere with YedZ-host protein interactions

  • Design immunotherapeutic approaches targeting surface-exposed YedZ epitopes

• Resistance management strategies:

  • Analyze potential resistance mechanisms to YedZ inhibitors

  • Develop multi-target approaches combining YedZ inhibition with other mechanisms

  • Create cycling regimens to prevent resistance emergence

  • Implement adaptive treatment algorithms based on YedZ sequence variants

• Translational research considerations:

  • Establish appropriate animal models for testing YedZ-targeted therapeutics

  • Develop biomarkers for monitoring YedZ inhibition in vivo

  • Create high-throughput screening platforms specific for YedZ activity

  • Design early-stage clinical trials focusing on infections where YedZ plays a critical role

This strategic framework illustrates how fundamental understanding of YedZ function can translate into practical antimicrobial development pathways with potential clinical impact against Yersinia pseudotuberculosis and potentially other bacterial pathogens with homologous systems.

What are the key knowledge gaps that remain in our understanding of YedZ function?

Despite advances in characterizing YedZ, several critical knowledge gaps remain that present opportunities for future research:

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetic manipulation, biochemical characterization, and in vivo infection models to fully elucidate the multifaceted roles of YedZ in bacterial physiology and pathogenesis.

How should researchers prioritize future studies on YedZ to maximize impact on both basic science and applied research?

To maximize the impact of future YedZ research on both basic science and applied research, investigators should prioritize their efforts according to this strategic framework:

• Highest priority: Fundamental mechanistic understanding

  • Solve the high-resolution structure of YedZ using cryo-EM or X-ray crystallography

  • Characterize the complete YedZ interactome under various physiological conditions

  • Define the precise catalytic mechanism and electron transfer pathway

  • Establish the full range of physiological substrates

• High priority: Pathogenesis relevance

  • Create defined yedZ mutants in multiple Yersinia pseudotuberculosis serotypes

  • Evaluate virulence in relevant animal models of infection

  • Compare with other bacterial sulfoxide reductase systems

  • Determine contribution to specific virulence phenotypes (adhesion, invasion, immune evasion)

• Medium priority: Comparative biology

  • Conduct systematic comparison with eukaryotic methionine sulfoxide reductases

  • Perform evolutionary analysis across bacterial species

  • Investigate potential horizontal gene transfer events

  • Analyze selective pressure on different YedZ domains

• Medium priority: Technology development

  • Create biosensors for real-time monitoring of YedZ activity

  • Develop high-throughput screening methods for YedZ inhibitors

  • Establish standardized assays for quantifying YedZ contributions to stress resistance

  • Engineer reporter systems for tracking YedZ expression in vivo

• Applied research priorities

  • Screen for small-molecule inhibitors of YedZ function

  • Validate YedZ as an antimicrobial target in infection models

  • Develop diagnostic tools based on YedZ sequence variants

  • Investigate potential vaccine applications targeting YedZ epitopes

• Interdisciplinary priority: Data integration

  • Create comprehensive databases of YedZ variants across bacterial species

  • Develop predictive models of YedZ function based on sequence

  • Establish standardized protocols for YedZ characterization

  • Form collaborative networks spanning multiple research disciplines