Recombinant Yersinia pseudotuberculosis serotype O:3 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction

ArnC (Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase) is a recombinant enzyme critical for synthesizing the O-antigen of Yersinia pseudotuberculosis serotype O:3. This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) onto undecaprenyl phosphate, a lipid carrier, initiating O-antigen biosynthesis . The O-antigen is a key component of lipopolysaccharide (LPS), a major virulence factor enabling Yersinia to evade host immune responses .

Enzymatic Role

ArnC transfers Ara4FN to undecaprenyl phosphate, forming the precursor for O-antigen synthesis. In Y. pseudotuberculosis O:3, this step is essential for constructing a branched O-unit with a di- to tetrasaccharide repeat, which includes 2-acetamido-2-deoxygalactose (GalNAc) as the initiating sugar .

Recombinant Production

ArnC is expressed in E. coli as a His-tagged protein and purified via affinity chromatography. Key specifications include:
| Form | Lyophilized powder (with 6% trehalose) |
| Storage Buffer | Tris/PBS-based buffer, pH 8.0 (with 50% glycerol for long-term storage) |
| Reconstitution | Deionized water (0.1–1.0 mg/mL), with 5–50% glycerol added for stability |

Note: Repeated freeze-thaw cycles are discouraged .

Functional Validation

The enzyme’s activity is inferred from its role in O-antigen biosynthesis. While direct enzymatic assays are not detailed in available sources, its recombinant expression aligns with studies on Yersinia LPS genetics .

Diagnostic and Vaccine Development

ArnC is used in serotyping assays (e.g., ELISA) . Its recombinant form enables:

  • Antigenic Profiling: Differentiating Y. pseudotuberculosis O:3 from other serotypes .

  • Immune Response Studies: Investigating host interactions with O-antigen components .

Genomic Insights

The arnC gene resides in the O-antigen gene cluster, often located near hemH-gsk in Y. pseudotuberculosis . Its genomic context includes genes encoding glycosyltransferases and polymerases .

Key Research Findings

  1. O-Antigen Regulation: ArnC activity is temperature-dependent. At 37°C, Y. pseudotuberculosis downregulates O-antigen expression, favoring short-chain LPS (SR-form) .

  2. Structural Diversity: The O:3 O-unit includes minor hexosylation (e.g., glucosylation) in SR-form LPS, modulated by environmental conditions .

  3. Phylogenetic Links: The arnC gene cluster in Y. kristensenii O:11 shares homology with E. coli O98, suggesting horizontal gene transfer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
arnC; YPK_1832; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
arnC
Target Protein Sequence
MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIILVDDGSSDNSTELLTA AANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEEIPRLVHVAEEG YDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHER STFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMYDLITCLTTTPLRLLSLVG SAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFVQKVVGAEQTENNQDVEK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.
Database Links

KEGG: ypy:YPK_1832

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ArnC in Yersinia pseudotuberculosis?

ArnC in Y. pseudotuberculosis functions as a glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) to undecaprenyl phosphate (UndP) in the bacterial inner membrane. This reaction is a critical step in lipopolysaccharide (LPS) modification that confers resistance to cationic antimicrobial peptides, including polymyxins . The enzymatic product of ArnC is subsequently deformylated by ArnD and transported to the outer surface of the inner membrane through mechanisms that are not yet fully characterized .

ArnC belongs to the glycosyltransferase-2 (GT-2) family and contains a conserved DxD motif (100DADLQ104 in Salmonella's ArnC) that coordinates divalent cations for the catalytic reaction with UDP-linked sugar donors . The protein contains multiple distinct structural regions that contribute to its membrane association and function.

How is ArnC structurally organized?

Based on structural studies of homologous ArnC from Salmonella typhimurium, the enzyme consists of three main regions :

  • N-terminal region (residues 1-153): Contains a Rossman-like α-β domain similar to the canonical GT-A domain common in GT-2 family glycosyltransferases

  • Interface helices (IH1 and IH2): These amphipathic helices (residues 134-153 and 213-229) lie along the plane of the membrane with hydrophobic residues facing the membrane

  • Transmembrane region: Consists of two transmembrane helices (TM1: residues 232-256 and TM2: residues 267-304) that anchor the protein in the inner membrane

The protein forms a stable tetramer with C2 symmetry through interactions in the C-terminal region that protrudes into the cytosol . This oligomeric structure is likely important for ArnC's enzymatic function.

How is the arnC gene regulated in Yersinia pseudotuberculosis?

The arnC gene is part of the arnBCDTEF operon, which is regulated by two-component systems responsive to environmental stresses, particularly PhoP/PhoQ and PmrA/PmrB . In Yersinia species, activation of these systems occurs in response to:

  • Low magnesium concentrations

  • Acidic pH

  • Presence of antimicrobial peptides

  • Envelope stress conditions

The PhoP/PhoQ system plays a crucial role in maintaining membrane permeability and reducing membrane depolarization under stress conditions . In Y. pseudotuberculosis specifically, the Cpx envelope stress system also influences resistance mechanisms by regulating various cell envelope components .

What are effective approaches for recombinant expression and purification of ArnC?

Successful recombinant expression of ArnC requires careful consideration of its membrane-associated nature. Based on documented approaches , an effective protocol would include:

  • Construct design:

    • Full-length construct including transmembrane domains

    • Truncated constructs removing membrane-spanning regions

    • Addition of affinity tags (His6 at N- or C-terminus)

  • Expression systems:

    • E. coli BL21(DE3) for initial screening

    • C41(DE3) or C43(DE3) strains optimized for membrane protein expression

    • Controlled expression using IPTG-inducible or auto-induction systems

  • Purification strategy:

    • Membrane fraction isolation by differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG)

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for oligomeric state assessment

During purification, including stabilizing agents such as glycerol (10-15%) and maintaining divalent cations (Mg2+ or Mn2+) at 1-5 mM concentration improves protein stability .

What enzymatic assays can be used to evaluate ArnC activity?

Several complementary approaches can be employed to assess ArnC activity:

  • Radioactive assay:

    • Monitoring transfer of [14C]- or [3H]-labeled Ara4FN from UDP-L-Ara4FN to UndP

    • Quantification by thin-layer chromatography or scintillation counting

  • Mass spectrometry-based assay:

    • Direct detection of UndP-Ara4FN product formation

    • Analysis of lipid A modifications using MALDI-TOF MS

  • Fluorescence-based assays:

    • Coupling ArnC activity to ArnD deformylation

    • Monitoring UDP release using coupled enzyme assays

  • Complementation assays:

    • In vivo restoration of polymyxin resistance in arnC mutants

    • Determination of minimum inhibitory concentrations (MICs)

A typical in vitro enzymatic assay reaction mixture would contain:

  • 50 mM HEPES buffer (pH 7.5)

  • 1-5 mM MgCl2 or MnCl2

  • 0.1-1% appropriate detergent (DDM)

  • 50-100 μM UndP substrate

  • 50-100 μM UDP-L-Ara4FN donor

  • 0.1-1 μM purified ArnC enzyme

How can genetic manipulation approaches be used to study arnC function?

Several genetic techniques have proven effective for investigating arnC function:

  • Gene deletion strategies:

    • Homologous recombination using suicide vectors

    • Lambda Red recombineering for scarless deletion

    • CRISPR-Cas9 mediated mutagenesis

  • Complementation studies:

    • Expression of wild-type arnC in trans from inducible promoters

    • Site-directed mutagenesis of conserved catalytic residues

    • Domain swap experiments with homologs

  • Reporter systems:

    • Transcriptional fusions to monitor arnC expression

    • Translational fusions to assess protein localization

  • Phenotypic analyses:

    • Susceptibility testing with polymyxins and other antimicrobials

    • Membrane integrity assays (propidium iodide uptake)

    • Microscopic examination of cell morphology

For example, deletion of arnC in Y. pseudotuberculosis can be achieved using the pDM4 suicide vector with ~500 bp homology arms flanking the gene, followed by selection on sucrose to identify second recombination events . Confirmation can be performed by PCR and phenotypic assessment of polymyxin susceptibility.

How exactly does ArnC contribute to polymyxin resistance?

ArnC plays a critical role in modifying lipopolysaccharide (LPS) to reduce binding of cationic antimicrobial peptides through the following mechanism:

  • ArnC catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP-L-Ara4FN to undecaprenyl phosphate (UndP) in the inner membrane

  • The resulting UndP-Ara4FN is deformylated by ArnD to produce UndP-Ara4N

  • This intermediate is transported across the inner membrane and the Ara4N moiety is transferred to the lipid A portion of LPS

  • The addition of Ara4N to lipid A reduces the negative charge of the bacterial outer membrane, decreasing the binding affinity of cationic antimicrobial peptides like polymyxins

The importance of this pathway is demonstrated by the significant decrease in polymyxin resistance observed in strains with deletions in the arn operon genes . In Y. enterocolitica, which is closely related to Y. pseudotuberculosis, this modification is regulated by the PhoP/PhoQ two-component system in response to environmental signals .

What methods are most effective for quantifying the impact of ArnC on antimicrobial resistance?

To assess ArnC's contribution to antimicrobial resistance, researchers can employ these methodologies:

  • Minimum Inhibitory Concentration (MIC) determination:

    • Broth microdilution assays comparing wild-type vs. arnC mutants

    • E-test gradient diffusion method

    • Time-kill kinetics assays at sub-MIC concentrations

  • Molecular characterization of LPS modifications:

    • MALDI-TOF mass spectrometry of purified lipid A

    • Chromatographic separation coupled with tandem mass spectrometry

    • 31P NMR spectroscopy for phosphate group analysis

  • Membrane interaction studies:

    • Polymyxin binding assays with fluorescently labeled derivatives

    • Membrane permeability assays (NPN uptake, propidium iodide)

    • Surface plasmon resonance measurements of polymyxin binding kinetics

  • Transcriptional response analysis:

    • RT-qPCR measurement of arnC expression under various conditions

    • RNA-seq to identify compensatory mechanisms in arnC mutants

    • ChIP-seq to map regulatory binding sites in the arn operon

StrainPolymyxin B MIC (μg/ml)Polymyxin E MIC (μg/ml)Lipid A-Ara4N (% modification)
Wild-type8-164-860-80%
ΔarnC0.25-0.50.125-0.25<5%
ΔarnC + pArnC4-82-440-60%
ΔphoPQ0.5-10.25-0.510-20%

Note: These values are representative based on similar studies in Yersinia species and may vary depending on specific experimental conditions .

How conserved is ArnC across Yersinia species and other Gram-negative bacteria?

ArnC exhibits varying degrees of conservation across bacterial species, with important implications for evolutionary adaptation to different ecological niches:

  • Within Yersinia genus:

    • High conservation between Y. pseudotuberculosis and Y. pestis (>95% amino acid identity)

    • Y. enterocolitica ArnC shows ~80-85% identity to Y. pseudotuberculosis

    • Some sRNAs controlling ArnC expression differ between Y. pseudotuberculosis and Y. pestis, suggesting evolutionary changes in post-transcriptional regulation

  • Across Enterobacteriaceae:

    • Moderate conservation with Salmonella typhimurium ArnC (~70-75% identity)

    • Lower conservation with E. coli ArnC (~60-65% identity)

    • Structural features like the DxD motif and transmembrane topology are highly conserved

  • Other Gram-negative pathogens:

    • Burkholderia pseudomallei contains ArnC homologs that have been investigated as potential drug targets

    • Klebsiella pneumoniae ArnC plays a similar role in polymyxin resistance

The structural organization of ArnC as determined for S. typhimurium can be compared with other membrane-bound glycosyltransferases like GtrB and DPMS, revealing conserved catalytic mechanisms despite sequence divergence .

What experimental approaches can best elucidate functional differences of ArnC between Yersinia pseudotuberculosis and other bacterial species?

To investigate functional differences between ArnC homologs, consider these methodological approaches:

  • Complementation studies:

    • Express ArnC from different species in Y. pseudotuberculosis ΔarnC

    • Measure restoration of polymyxin resistance and lipid A modification

    • Construct chimeric proteins to identify species-specific functional domains

  • Biochemical characterization:

    • Compare substrate specificity using purified enzymes

    • Determine kinetic parameters (Km, kcat) with various UDP-sugar donors

    • Analyze metal ion preferences and pH optima

  • Structural biology approaches:

    • Solve structures of ArnC from multiple species (X-ray crystallography, cryo-EM)

    • Perform molecular dynamics simulations to identify species-specific conformational differences

    • Map conservation onto structural models to identify functionally divergent regions

  • Regulatory network comparison:

    • Analyze transcriptional responses across species using RNA-seq

    • Map small RNA interactions that may differ between species

    • Identify species-specific post-translational modifications

SpeciesArnC Size (aa)Optimal pHTemperature OptimumKey Regulatory Elements
Y. pseudotuberculosis313-3157.0-7.526-37°CPhoP/PhoQ, Cpx, Hfq-dependent sRNAs
Y. pestis313-3157.0-7.528-37°CPhoP/PhoQ, different sRNA profiles
S. typhimurium3136.5-7.537°CPhoP/PhoQ, PmrA/PmrB, PmrD connector
E. coli310-3127.0-8.037°CPhoP/PhoQ, lacks effective PmrD function

Note: Some values are inferential based on related studies and general knowledge of these organisms .

How can structural insights into ArnC inform the development of specific inhibitors?

The cryo-EM structures of ArnC from S. typhimurium provide a foundation for structure-based inhibitor design approaches :

  • Target site identification:

    • The UDP binding pocket formed by the A-loop (residues 201-213) and interface helices (IH1 and IH2) offers a promising target site

    • The DxD motif (100DADLQ104) involved in coordinating divalent cations is critical for catalysis

    • Protein-protein interfaces in the tetrameric assembly could be targeted to disrupt oligomerization

  • Rational design strategies:

    • Design UDP analogs that compete with the natural substrate

    • Develop compounds that lock the A-loop in an inactive conformation

    • Target species-specific residues within the catalytic pocket for selective inhibition

  • Fragment-based approaches:

    • Screen small molecule fragments that bind to the active site

    • Employ differential scanning fluorimetry to identify stabilizing compounds

    • Use structure-activity relationship studies to optimize lead compounds

  • Computational methods:

    • Molecular docking of virtual compound libraries

    • MD simulations to identify transient binding pockets

    • Free energy perturbation calculations to predict binding affinities

The observed conformational changes upon UDP binding, including stabilization of the A-loop and repositioning of IH2 towards the binding pocket , provide important mechanistic insights that can guide inhibitor design. Additionally, understanding the differences between ArnC and human glycosyltransferases is crucial for developing selective inhibitors with minimal off-target effects.

What experimental approaches can determine how small RNAs regulate arnC expression in Yersinia pseudotuberculosis?

Small RNAs have been implicated in the regulation of virulence factors in Y. pseudotuberculosis, including potential control of arnC expression . The following experimental approaches can elucidate these regulatory mechanisms:

  • RNA-seq and differential expression analysis:

    • Compare wild-type vs. Hfq mutant strains to identify Hfq-dependent sRNAs

    • Analyze expression at different temperatures (26°C vs. 37°C) to identify temperature-regulated sRNAs

    • Perform targeted sequencing of small RNA fractions (<200 nt)

  • sRNA target identification:

    • In silico prediction of sRNA-mRNA interactions using algorithms like IntaRNA

    • RNA co-immunoprecipitation with Hfq followed by sequencing (RIP-seq)

    • MS2-affinity purification coupled with RNA sequencing (MAPS)

    • CLASH (crosslinking, ligation, and sequencing of hybrids) to identify direct interactions

  • Functional validation:

    • Construct sRNA deletion strains and assess arnC expression by RT-qPCR

    • Generate translational fusions of arnC with reporter genes (GFP, luciferase)

    • Perform site-directed mutagenesis of predicted sRNA binding sites

    • Express sRNAs from inducible promoters and measure effects on target expression

  • In vitro binding studies:

    • Electrophoretic mobility shift assays (EMSA) with purified sRNAs and target mRNAs

    • Surface plasmon resonance to measure binding kinetics

    • Structure probing experiments (SHAPE, hydroxyl radical footprinting)

Research has identified that Hfq, an RNA chaperone that mediates sRNA-mRNA interactions, is required for virulence in Y. pseudotuberculosis, with an hfq deletion resulting in ~10,000-fold attenuation in a mouse model . This suggests that Hfq-dependent sRNAs play critical roles in regulating virulence determinants, potentially including arnC.

How can the ArnC-dependent lipid A modification pathway be manipulated to enhance bacterial susceptibility to host immune responses?

Targeting the ArnC-dependent pathway offers opportunities to enhance bacterial clearance through multiple strategic approaches:

  • Immune evasion reversal:

    • Inhibition of ArnC prevents Ara4N modification of lipid A

    • Unmodified lipid A maintains negative charge, enhancing binding of:

      • Host antimicrobial peptides (defensins, cathelicidins)

      • Complement components

      • Cationic proteins from neutrophil granules

  • TLR4 signaling modulation:

    • Design experimental protocols to assess how ArnC inhibition affects:

      • Macrophage cytokine production profiles

      • Neutrophil recruitment and activation

      • Dendritic cell maturation and antigen presentation

  • Combination therapy approaches:

    • Test ArnC inhibitors with:

      • Sub-inhibitory concentrations of polymyxins

      • Host-derived antimicrobial peptides

      • Immunomodulatory compounds that enhance innate immunity

  • In vivo assessment methods:

    • Develop mouse infection models comparing:

      • Wild-type Y. pseudotuberculosis

      • arnC deletion mutants

      • Strains with induced arnC inhibition

    • Measure bacterial burden, inflammatory responses, and survival rates

A comprehensive experimental design would include:

  • In vitro assessment of polymyxin susceptibility and antimicrobial peptide binding

  • Ex vivo macrophage infection studies measuring bacterial survival and cytokine production

  • In vivo infection models with immune parameter monitoring

  • Histopathological analysis of infected tissues

Treatment ConditionBacterial Survival in Macrophages (%)TNF-α Production (pg/ml)IL-6 Production (pg/ml)Neutrophil Recruitment Score
Wild-type65-80%800-12001500-2000+
ΔarnC15-25%2000-30003500-4500+++
Wild-type + ArnC inhibitor20-30%1800-25003000-4000+++
ΔarnC + complementation55-70%900-13001700-2200+

Note: These values are representative examples based on similar studies of bacterial virulence factors and would need experimental validation .

What are the main challenges in expressing and purifying active recombinant ArnC for structural studies?

Researchers face several significant technical challenges when attempting to produce recombinant ArnC for structural and functional studies:

  • Membrane protein solubilization issues:

    • ArnC contains transmembrane domains that make it difficult to extract and maintain in solution

    • Selection of appropriate detergents is critical (DDM, LMNG, or GDN typically work best)

    • Detergent concentration must be optimized to prevent protein aggregation while minimizing excess micelle formation

  • Maintaining enzymatic activity:

    • The tetrameric structure of ArnC is essential for function

    • Detergent solubilization can disrupt native oligomeric states

    • Loss of specific lipid interactions may compromise activity

  • Expression optimization challenges:

    • Toxic effects when overexpressed in bacterial systems

    • Codon optimization requirements for heterologous expression

    • Inclusion body formation requiring refolding protocols

  • Stability considerations:

    • Thermal instability of purified protein

    • Oxidation sensitivity of conserved cysteine residues

    • Batch-to-batch variability in activity

To address these challenges, researchers have employed various strategies:

  • Expression of truncated constructs removing transmembrane regions

  • Use of nanodiscs or amphipols to maintain native-like membrane environments

  • Addition of stabilizing agents (glycerol, specific lipids) to purification buffers

  • Co-expression with chaperones to improve folding

For example, Sullivan et al. reported successful recombinant production of both full-length and truncated forms of ArnC from B. pseudomallei, assessing monodispersity using size exclusion chromatography coupled to laser light scattering and thermal stability via differential scanning fluorimetry .

How can researchers design effective experiments to study the interplay between ArnC and other components of the LPS modification pathway?

Understanding the coordinated actions of ArnC with other enzymes in the LPS modification pathway requires sophisticated experimental approaches:

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged ArnC to identify interaction partners

    • Bacterial two-hybrid systems for membrane protein interaction screening

    • In vivo crosslinking followed by mass spectrometry identification

    • FRET-based approaches to detect proximity between pathway components

  • Reconstitution of multi-enzyme pathways:

    • Liposome reconstitution with purified ArnB, ArnC, ArnD, and ArnT

    • Cell-free expression systems for coupled enzymatic reactions

    • Development of assays that monitor sequential modification steps

  • Genetic approaches to assess functional relationships:

    • Construction of double and triple mutants in the arn operon

    • Suppressor mutation screening to identify compensatory pathways

    • Synthetic lethality approaches to map genetic interactions

  • Spatiotemporal organization studies:

    • Super-resolution microscopy to visualize enzyme localization

    • Single-molecule tracking to examine dynamics

    • Pulse-chase experiments to determine reaction sequence kinetics

A model experimental design might include:

  • Construction of differentially tagged Arn proteins (ArnB-GFP, ArnC-mCherry, ArnD-BFP)

  • Co-expression in minimal systems (reconstituted liposomes or E. coli with deleted native arn genes)

  • Analysis of protein co-localization under varying conditions (Mg2+ depletion, pH stress)

  • Correlation of localization patterns with functional outcomes (LPS modification, polymyxin resistance)

This approach has been validated in part by studies demonstrating physical interactions between ArnB and ArnA in pull-down experiments, suggesting that components of this pathway may form functional complexes .

How does ArnC-mediated LPS modification affect Yersinia pseudotuberculosis virulence in animal models?

The role of ArnC in Y. pseudotuberculosis virulence can be systematically assessed through animal model studies:

  • Mouse infection models:

    • Oral infection to mimic natural transmission route

    • Intravenous infection to assess systemic spread

    • Comparison of wild-type vs. arnC deletion strains for:

      • Bacterial burden in tissues (spleen, liver, mesenteric lymph nodes)

      • Survival rates and time to disease onset

      • Histopathological changes in infected tissues

  • Correlation with virulence mechanisms:

    • Assessment of bacterial survival in macrophages

    • Resistance to antimicrobial peptides in serum and tissues

    • Ability to form microcolonies and evade immune clearance

  • Interaction with host recognition systems:

    • Impact on TLR4-mediated recognition of LPS

    • Alterations in inflammasome activation

    • Changes in cytokine/chemokine profiles during infection

Research has shown that deletion of various sRNAs in Y. pseudotuberculosis, which could potentially regulate arnC expression, leads to attenuation of the pathogen in a mouse model of yersiniosis . Furthermore, inactivation of a conserved Yersinia-specific sRNA in Y. pestis causes attenuation in a mouse model of pneumonic plague , suggesting important regulatory connections between post-transcriptional regulation and virulence.

What methodologies can best determine how environmental signals regulate arnC expression during infection?

Understanding the dynamic regulation of arnC during the infection process requires specialized experimental approaches:

  • In vivo expression technology (IVET):

    • Construction of arnC promoter fusions to reporter genes

    • Monitoring expression patterns during different stages of infection

    • Identification of host microenvironments that induce expression

  • Single-cell analysis techniques:

    • Flow cytometry of bacteria recovered from infected tissues

    • RNA-seq of bacterial populations isolated from different infection sites

    • Dual RNA-seq to simultaneously profile host and pathogen transcriptomes

  • Environmental signal simulation:

    • Microfluidic devices to create gradients of relevant signals

    • Controlled exposure to host antimicrobial factors

    • Sequential exposure to mimic infection progression

  • Reporter systems for specific regulatory inputs:

    • Construction of reporter strains responsive to:

      • PhoP/PhoQ activation

      • Cpx envelope stress system signaling

      • Iron limitation conditions

      • Antimicrobial peptide exposure

These methodologies can reveal how arnC expression responds to:

  • pH changes during gastrointestinal transit

  • Magnesium limitation in intracellular compartments

  • Antimicrobial peptide exposure in intestinal mucosa

  • Oxygen limitation in microcolonies

The Cpx envelope stress system in Y. pseudotuberculosis has been shown to influence virulence by regulating global transcriptional regulators like RovA and RovM . Since Cpx signaling responds to cell envelope damage and upregulates factors that restore envelope integrity, it likely plays a role in coordinating arnC expression during infection.

What are the most promising approaches for developing high-throughput screening assays to identify ArnC inhibitors?

Development of effective high-throughput screening (HTS) assays for ArnC inhibitors requires balancing throughput with biological relevance:

  • Biochemical assay approaches:

    • UDP-Glo™ assay to detect UDP release during catalysis

    • Fluorescence polarization assays with labeled UDP-Ara4FN

    • FRET-based assays monitoring substrate-product conversion

    • Thermal shift assays to identify compounds that bind ArnC

  • Cell-based screening systems:

    • Reporter strains with arnC promoter driving luciferase expression

    • Growth inhibition assays in the presence of sub-lethal polymyxin concentrations

    • Bacterial cytological profiling to identify envelope stress signatures

  • Computational pre-screening strategies:

    • Virtual screening against the UDP binding pocket

    • Pharmacophore modeling based on UDP and substrate interactions

    • Molecular dynamics simulations to identify transient binding pockets

  • Assay optimization considerations:

    • Miniaturization to 384 or 1536-well format

    • Z-factor determination for assay robustness

    • Positive and negative controls (UDP analogs, inactive enzyme)

A robust screening cascade would include:

  • Primary screening using a simple biochemical assay (e.g., UDP-Glo™)

  • Secondary validation with orthogonal assays (thermal shift, binding)

  • Tertiary cell-based assays to confirm membrane permeability and target engagement

  • Quaternary specificity testing against related glycosyltransferases

The identification of the A-loop (residues 201-213) as a structurally labile element that stabilizes upon UDP binding provides a promising target for compounds that could lock this region in an inactive conformation .

How might interdisciplinary approaches advance our understanding of ArnC function and its potential as a therapeutic target?

Advancing ArnC research requires integration of multiple disciplines and technologies:

  • Structural biology and biophysics:

    • High-resolution cryo-EM of Y. pseudotuberculosis ArnC in multiple states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Nuclear magnetic resonance studies of substrate binding and catalysis

  • Systems biology approaches:

    • Network analysis of regulatory connections controlling arnC expression

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Machine learning to predict regulatory responses to environmental conditions

  • Synthetic biology tools:

    • Construction of minimal systems reconstituting Ara4N modification

    • Biosensors detecting ArnC activity in real-time

    • Controlled expression systems to titrate pathway components

  • Immunology and host-pathogen interactions:

    • Examination of how modified LPS affects innate immune recognition

    • Assessment of vaccine potential of strains with altered LPS

    • Investigation of species-specific differences in host responses

  • Medicinal chemistry and drug delivery:

    • Fragment-based drug discovery targeting ArnC

    • Development of prodrugs to enhance bacterial penetration

    • Nanoparticle delivery systems for targeted inhibitor deployment

The integrated knowledge from these approaches could lead to:

  • Novel antibacterial strategies targeting resistance mechanisms

  • Understanding of bacterial adaptation during infection

  • Broad-spectrum approaches applicable to multiple Gram-negative pathogens

  • Combination therapies enhancing effectiveness of existing antibiotics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.