Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0208 membrane protein YPK_1552 (YPK_1552)

Shipped with Ice Packs
In Stock

Description

Introduction

Proteins are essential to biological functions, and their structure dictates their function . The primary structure of a protein, which is the unique sequence of amino acids, determines how the protein folds into a three-dimensional conformation. This conformation then determines the protein's function .

General Information

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0208 membrane protein YPK_1552 (YPK_1552) is a protein expressed by the bacterium Yersinia pseudotuberculosis. Yersinia species use a type 3 secretion system (T3SS) to inject Yersinia effector proteins (Yops) into host cells to suppress neutrophil responses .

Yersinia pseudotuberculosis and Yops

Yersinia pseudotuberculosis is an enteropathogen that can survive in lymphoid compartments that are abundant in immune cells . This survival depends on plasmid-encoded Yersinia outer proteins (Yops) that are delivered into the host cell via a mechanism involving the Yersinia type III secretion system . Yops like YopH and YopE are responsible for resistance against PMN-mediated phagocytic uptake .

YopH Function

YopH is a tyrosine phosphatase that is involved in the dephosphorylation of the adaptor protein SKAP2, among other targets in neutrophils . SKAP2 plays a role in reactive oxygen species (ROS) production, phagocytosis, and integrin-mediated migration by neutrophils . YopH protects Yersinia pseudotuberculosis from neutrophil-produced reactive oxygen species (ROS) and degranulation by interfering with signaling pathways .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YPK_1552; UPF0208 membrane protein YPK_1552
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
YPK_1552
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLSEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: ypy:YPK_1552

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YPK_1552 and why is it significant in research?

YPK_1552 is a UPF0208 membrane protein from Yersinia pseudotuberculosis serotype O:3 (strain YPIII). It belongs to an uncharacterized protein family (UPF0208) with potential significance in bacterial membrane structure and function. As an integral membrane protein, it likely contributes to membrane properties and cellular processes. The protein consists of 151 amino acids in its full-length form and is significant for research into bacterial pathogenesis, membrane biology, and potential therapeutic target identification .

What is the structure and typical expression system for recombinant YPK_1552?

Recombinant YPK_1552 is typically expressed in E. coli expression systems, though other expression hosts including yeast, mammalian cells, and baculovirus are also viable options depending on research requirements . The protein is available as a full-length construct (1-151 amino acids) and can be tagged with various fusion proteins such as His-tag for purification purposes . The protein's structure has not been fully characterized in the provided sources, but as a membrane protein, it is expected to contain hydrophobic regions that interact with the phospholipid bilayer .

How does YPK_1552 compare to other membrane proteins from Yersinia species?

While the provided search results don't offer direct comparisons between YPK_1552 and other Yersinia membrane proteins, membrane proteins generally play crucial roles in bacterial virulence, signaling, and interaction with host cells. YPK_1552 belongs to the UPF0208 family, which suggests it has functions that are not yet fully characterized but conserved across certain bacterial species. As with other integral membrane proteins, YPK_1552 likely influences membrane properties such as stiffness and fluidity, which can affect cellular processes and bacterial survival .

What are the known functions of UPF0208 family membrane proteins?

The UPF0208 (Uncharacterized Protein Family 0208) proteins, including YPK_1552, have not been extensively functionally characterized according to the available search results. The "UPF" designation indicates that these proteins are recognized by sequence but their biochemical and cellular functions remain largely unknown. As integral membrane proteins, they likely contribute to membrane structure, stability, and possibly transport functions. Research suggests that integral membrane proteins like YPK_1552 can modify membrane stiffness, potentially influencing cellular processes that depend on membrane flexibility and dynamics .

How does YPK_1552 affect membrane stiffness and cellular mechanics?

While specific studies on YPK_1552's effect on membrane stiffness are not detailed in the search results, research on integral membrane proteins indicates they can significantly alter membrane mechanical properties. Computer simulations demonstrate that integral membrane proteins at physiological densities modify membrane stiffness (characterized by bending rigidity, Kc). For example, the bacterial outer membrane protein BtuB reduces membrane stiffness in a density-dependent manner .

YPK_1552, as an integral membrane protein, would likely influence membrane stiffness through protein-lipid interactions, potentially affecting cellular processes dependent on membrane deformation, such as vesicle formation, cell division, and response to mechanical stress. This effect might be particularly important for the bacterial pathogen's ability to adapt to different environmental conditions during infection .

What role might YPK_1552 play in Yersinia pseudotuberculosis pathogenesis?

Though the specific role of YPK_1552 in pathogenesis is not explicitly described in the search results, we can make informed inferences based on the importance of membrane proteins in bacterial pathogens. As a membrane protein in Y. pseudotuberculosis, YPK_1552 could potentially be involved in:

  • Membrane integrity and stability during infection

  • Adaptation to host environments

  • Resistance to host defense mechanisms

  • Potential interactions with host cell receptors

  • Contribution to virulence mechanisms

Understanding its role would require specific experimental approaches such as gene knockout studies, virulence assays, and host-pathogen interaction analyses to determine if and how YPK_1552 contributes to the bacterium's ability to cause disease .

What protein-protein interactions has YPK_1552 been shown to participate in?

Protein interaction studies would be valuable for understanding YPK_1552's functional role in Y. pseudotuberculosis. Similar to case studies with other proteins like NME1 and DNM2 where two-way co-immunoprecipitation confirmed their interaction and functional relevance, research could employ techniques such as affinity purification coupled with mass spectrometry (AP-MS) or proximity labeling methods to identify YPK_1552's interaction network .

How does YPK_1552 influence signaling pathways in bacterial cells?

  • Changes in phosphorylation states of potential downstream effectors in YPK_1552 mutant strains

  • Alterations in second messenger levels (such as cyclic di-GMP or cyclic AMP)

  • Transcriptional responses to environmental stimuli in the presence and absence of functional YPK_1552

  • Potential sensing capabilities for environmental conditions

Such investigations would help determine whether YPK_1552 participates in signaling cascades relevant to bacterial adaptation, survival, or virulence, similar to how researchers studied EGF-EGFR signaling in the context of NME1-DNM2 interactions .

What are the optimal conditions for expressing and purifying recombinant YPK_1552?

Based on the search results, recombinant YPK_1552 can be expressed in several systems, with E. coli being the most commonly used. For optimal expression and purification:

  • Expression system selection: E. coli appears to be the primary expression system, though yeast, mammalian cells, and baculovirus systems are also viable alternatives depending on experimental needs .

  • Vector and tags: His-tagged constructs are commonly used to facilitate purification. If analyzing full-length protein expression is important, using fusion tags at both the N- and C-termini can help distinguish full-length from truncated products .

  • Purification strategy: For His-tagged proteins, immobilized metal affinity chromatography (IMAC) is typically used, with elution using increasing imidazole concentrations to ensure purification of full-length protein .

  • Solubilization: As a membrane protein, YPK_1552 likely requires detergents or other membrane-mimetic systems for solubilization after expression.

  • Post-purification handling: The protein is typically provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

What challenges might researchers face when working with YPK_1552 and how can they be addressed?

Researchers working with YPK_1552 may encounter several challenges typical for membrane proteins:

  • Expression challenges: Membrane proteins often face expression difficulties due to hydrophobicity, codon rarity, and potential toxicity to host cells. Solutions include:

    • Optimizing codon usage for the expression host

    • Using specialized membrane protein expression strains

    • Employing mild induction conditions

    • Considering fusion with solubility-enhancing tags

  • Translation initiation problems: Truncated products may result from proteolysis or improper translation initiation. This can be addressed by:

    • Using dual-tagged constructs (N- and C-terminal tags)

    • Optimizing translation initiation sequences

    • Including protease inhibitors during purification

    • Using stringent purification conditions (e.g., higher imidazole concentrations)

  • Membrane protein solubility: As an integral membrane protein, YPK_1552 requires special consideration for maintaining its native conformation:

    • Testing various detergents for optimal solubilization

    • Considering nanodiscs or liposomes for functional studies

    • Using membrane protein-specific buffer systems

  • Protein stability: Membrane proteins often have stability issues in solution:

    • Adding glycerol (5-50%) to storage buffers

    • Aliquoting to avoid freeze-thaw cycles

    • Storing at -80°C for long-term storage

What analytical methods are most effective for studying YPK_1552's impact on membrane properties?

To study YPK_1552's effects on membrane properties, researchers can employ several analytical approaches:

  • Bending rigidity measurements: Techniques such as flicker spectroscopy, micropipette aspiration, or optical tweezers can measure changes in membrane stiffness (Kc) when YPK_1552 is incorporated at different densities .

  • Computer simulations: Coarse-grained molecular dynamics simulations using force fields like MARTINI can model the interaction of YPK_1552 with lipid bilayers and predict effects on membrane properties, as has been done for other membrane proteins .

  • Fluorescence microscopy: Techniques like Fluorescence Recovery After Photobleaching (FRAP) can assess how YPK_1552 affects membrane fluidity and lipid diffusion.

  • Atomic Force Microscopy (AFM): AFM can directly measure the mechanical properties of membranes containing YPK_1552 at various concentrations.

  • Differential Scanning Calorimetry (DSC): DSC can determine how YPK_1552 affects lipid phase transitions and membrane organization.

These approaches would help elucidate YPK_1552's role in modifying membrane properties, which could be important for understanding its function in bacterial physiology and pathogenesis .

How can researchers determine YPK_1552's topology within the membrane?

Determining membrane protein topology is crucial for understanding function. Several experimental approaches can be used for YPK_1552:

  • Protease protection assays: Limited proteolysis of membrane vesicles containing YPK_1552, followed by identification of protected fragments, can reveal which regions are embedded in the membrane or exposed to either side.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions followed by accessibility studies with membrane-impermeable sulfhydryl reagents can map exposed regions.

  • Fluorescence quenching: Introducing fluorescent probes at specific positions and measuring their accessibility to membrane-impermeable quenchers can determine whether regions are inside or outside the membrane.

  • Computational prediction: Tools such as TMHMM, Phobius, or TOPCONS can provide initial predictions of transmembrane segments based on the amino acid sequence.

  • Reporter fusion constructs: Creating fusions with reporter proteins (such as GFP or alkaline phosphatase) at different positions can help determine which regions are cytoplasmic or periplasmic.

These complementary approaches would provide a comprehensive understanding of YPK_1552's membrane topology, which is essential for structural and functional studies .

How can YPK_1552 research contribute to understanding bacterial membrane adaptation?

Research on YPK_1552 can provide valuable insights into bacterial membrane adaptation mechanisms:

  • Membrane homeostasis: Studying how YPK_1552 influences membrane stiffness and fluidity can reveal mechanisms by which bacteria maintain membrane integrity under varying environmental conditions .

  • Stress response: Investigating YPK_1552 expression levels and membrane localization under different stress conditions (temperature, pH, antimicrobial exposure) could elucidate its role in membrane adaptation during stress.

  • Comparative studies: Analyzing YPK_1552 homologs across different Yersinia species and strains can reveal evolutionary adaptations in membrane protein function relevant to different ecological niches.

  • Protein-lipid interactions: Examining how YPK_1552 interacts with different lipid compositions can help understand bacterial adaptation to varying membrane environments during infection.

This research could have broader implications for understanding bacterial adaptation mechanisms, potentially leading to new approaches for controlling bacterial infections or developing membrane-targeting antimicrobials .

What potential does YPK_1552 have as a therapeutic target or diagnostic marker?

Although the search results don't specifically address YPK_1552's potential as a therapeutic target or diagnostic marker, several aspects warrant investigation:

  • Therapeutic targeting potential:

    • If YPK_1552 proves essential for Y. pseudotuberculosis virulence or survival, it could represent a novel antimicrobial target

    • Being a membrane protein, it might be more accessible to drugs than cytoplasmic targets

    • Species-specific regions could enable selective targeting of Yersinia without affecting commensal bacteria

  • Diagnostic applications:

    • If YPK_1552 contains unique epitopes, antibodies against it could be developed for diagnostic tests

    • Detection of YPK_1552 in clinical samples could potentially aid in rapid identification of Y. pseudotuberculosis infections

  • Vaccine development:

    • If surface-exposed regions of YPK_1552 are immunogenic and conserved, they might serve as candidates for subunit vaccines against Y. pseudotuberculosis

These potential applications would require extensive validation through structural analysis, immunological studies, and in vivo testing to determine YPK_1552's utility in therapeutic or diagnostic contexts .

How can researchers leverage YPK_1552 in membrane protein research methodology development?

YPK_1552 could serve as a model system for developing improved methodologies for membrane protein research:

  • Expression system optimization: The availability of YPK_1552 in multiple expression systems (E. coli, yeast, mammalian cells, baculovirus) makes it valuable for comparative studies of membrane protein expression methodologies .

  • Purification protocol refinement: As a relatively small membrane protein (151 amino acids), YPK_1552 could serve as a test case for developing improved purification strategies that maintain native conformation.

  • Structural biology approaches: Researchers could use YPK_1552 to refine techniques for membrane protein structural determination, including crystallography, cryo-EM, or NMR methods.

  • Biotinylation strategies: The availability of Avi-tag biotinylated versions of YPK_1552 makes it suitable for testing and optimizing various biotin-streptavidin based purification and detection methodologies .

  • Membrane reconstitution systems: YPK_1552 could be used to develop improved protocols for reconstituting membrane proteins into artificial membrane systems such as nanodiscs, liposomes, or polymer-based membranes.

These methodological advancements could benefit the broader field of membrane protein research, which faces significant technical challenges despite the biological importance of membrane proteins .

What are the major knowledge gaps in our understanding of YPK_1552?

Despite the availability of recombinant YPK_1552 for research, significant knowledge gaps remain:

  • Structure-function relationship: The three-dimensional structure of YPK_1552 remains unresolved, limiting our understanding of its molecular function .

  • Biological role: The specific biological functions of YPK_1552 in Y. pseudotuberculosis physiology and pathogenesis are poorly characterized .

  • Regulatory mechanisms: How YPK_1552 expression and localization are regulated under different conditions is unknown.

  • Interaction partners: While YPK_1552 is reported to interact with other proteins, these partners and the functional significance of these interactions remain to be fully elucidated .

  • Evolutionary conservation: The conservation of YPK_1552 across Yersinia species and strains, and its relationship to homologs in other bacteria, requires further investigation.

Addressing these knowledge gaps would significantly advance our understanding of this membrane protein and potentially reveal new insights into bacterial membrane biology and Yersinia pathogenesis .

What emerging technologies could accelerate research on YPK_1552 and similar membrane proteins?

Several emerging technologies hold promise for advancing YPK_1552 research:

  • AI-based structure prediction: Tools like AlphaFold2 could help predict YPK_1552's structure, providing insights into its function and guiding experimental design .

  • Single-particle cryo-EM: Advances in cryo-EM technologies, including the use of Volta phase plates and direct electron detectors, have improved resolution for small membrane proteins, potentially enabling structural determination of YPK_1552.

  • Native mass spectrometry: Emerging techniques in native mass spectrometry could help identify YPK_1552's interaction partners while maintaining native membrane environments.

  • Nanodiscs and membrane mimetics: Advanced membrane mimetic systems could enable functional studies of YPK_1552 in near-native environments.

  • CRISPR-based genome editing: CRISPR technologies could facilitate precise genetic manipulation of YPK_1552 in Y. pseudotuberculosis to study its function in vivo.

These technologies could collectively accelerate research on YPK_1552 and similar membrane proteins, leading to new insights into bacterial membrane biology and potential applications in medicine and biotechnology .

What collaborative research approaches would be most beneficial for advancing YPK_1552 research?

Advancing research on YPK_1552 would benefit from interdisciplinary collaborative approaches:

  • Structural biology and biophysics: Collaboration between structural biologists and biophysicists could help determine YPK_1552's structure and how it influences membrane properties .

  • Microbiology and infectious disease: Partnerships between microbiologists and infectious disease researchers could elucidate YPK_1552's role in Y. pseudotuberculosis pathogenesis.

  • Computational biology and biochemistry: Integrating computational predictions with biochemical validation could accelerate understanding of YPK_1552's function and interactions.

  • Method development and application: Collaboration between technology developers and biological researchers could optimize methods for membrane protein study using YPK_1552 as a model.

  • Translational research: Partnerships between basic scientists and clinical researchers could explore potential applications of YPK_1552 research in diagnostics or therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.