Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0259 membrane protein YPK_2050 (YPK_2050)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF Membrane Proteins in Yersinia pseudotuberculosis

Yersinia pseudotuberculosis is a gram-negative pathogenic bacterium responsible for various intestinal and systemic diseases in humans. The bacterium contains numerous uncharacterized protein families (UPF), including membrane-associated proteins that play crucial roles in bacterial metabolism and potentially in virulence . These membrane proteins are often studied through recombinant protein technology, where they are expressed in laboratory strains of E. coli with histidine tags to facilitate purification and subsequent research applications.

The UPF0259 membrane protein family represents a group of poorly characterized bacterial proteins that are integrated into cell membranes. Similar proteins from Y. pseudotuberculosis, such as UPF0259 membrane protein YPTB2121, have been successfully expressed as recombinant proteins and made commercially available for research purposes . These proteins are valuable for studying bacterial membrane structure, host-pathogen interactions, and for developing potential therapeutic targets.

Membrane proteins in Y. pseudotuberculosis operate within a complex metabolic network that influences both basic cellular functions and virulence characteristics. Research on this pathogen has revealed that membrane proteins often serve as crucial nexus points linking metabolism and virulence regulation.

Y. pseudotuberculosis employs a sophisticated carbon metabolism system with a pyruvate-TCA cycle node that serves as a metabolic switch point critical for virulence control . While the specific function of UPF0259 membrane proteins remains to be fully characterized, they likely participate in metabolic processes related to membrane transport, signaling, or energy generation based on their structural characteristics and cellular localization.

Systems biology approaches combining gene expression profiling with metabolic flux analysis have demonstrated that mutations in key regulatory genes can significantly alter carbon metabolism in Y. pseudotuberculosis, particularly affecting the pyruvate metabolism and tricarboxylic acid cycle . These metabolic perturbations have direct implications for virulence, suggesting that membrane proteins involved in metabolic processes could serve as potential targets for antimicrobial intervention.

Experimental Applications and Research Relevance

Recombinant membrane proteins from Y. pseudotuberculosis provide valuable tools for a variety of research applications. These include:

  1. Structural studies to understand membrane protein architecture

  2. Functional assays to elucidate roles in bacterial metabolism

  3. Development of antibodies for detection and localization studies

  4. Investigation of host-pathogen interactions

  5. Screening of potential antimicrobial compounds

The proteins are typically supplied in a form conducive to experimental manipulation, with recommended reconstitution protocols to ensure optimal activity. For instance, related recombinant proteins are provided with specific instructions for reconstitution: brief centrifugation prior to opening, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and addition of glycerol (5-50% final concentration) for long-term storage .

Relationship to Virulence and Pathogenicity

Y. pseudotuberculosis relies on precise regulation of virulence factors to successfully colonize hosts and withstand immune responses. Research has demonstrated that global regulators such as RovA, CsrA, and Crp influence both metabolic flux patterns and virulence gene expression . The interplay between metabolism and virulence is particularly evident at the pyruvate-TCA cycle junction, which serves as a focal point for controlling host colonization.

Membrane proteins, including those from the UPF families, may play integral roles in this regulatory network. By participating in nutrient transport, energy generation, or signaling pathways, these proteins could contribute to the bacterium's ability to adapt to changing environmental conditions during infection.

Studies utilizing mouse infection models have confirmed that disruption of key metabolic nodes can significantly reduce Y. pseudotuberculosis virulence . This finding underscores the potential importance of membrane proteins involved in these metabolic processes as both research subjects and therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPK_2050; UPF0259 membrane protein YPK_2050
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
YPK_2050
Target Protein Sequence
MPITANTLYRDSFNFLRNQIAAILLLALLTAFITVMLNQTFMPASEQLSILSIPENDITS SGNLSISEIVSQMTPEQQMVLLRVSAVATFSALVGNVLLVGGLLTLIAMVSQGRRVSALQ AIGLSLPILPRLLVLMFISTLVIQLGLTFFIVPGVAIAIALSLSPIIVTNERMGIFAAMK ASAQLAFANVRLIVPAMMLWIAVKLLLLFLISRFTVLPPTIATIVLSTLSNLASALLLVY LFRLYMLLRPVSLDKQ
Uniprot No.

Target Background

Database Links

KEGG: ypy:YPK_2050

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant YPK_2050?

For recombinant YPK_2050 protein, optimal storage requires specific conditions to maintain stability and biological activity:

  • Store at -20°C for regular use, or at -80°C for extended storage periods

  • Use a stabilizing buffer containing Tris buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and aggregation

  • For working stocks, prepare small aliquots and store at 4°C for up to one week

For daily experimental work, thawing a single-use aliquot rather than the entire stock is recommended. Internal validation studies suggest that proper storage in glycerol-supplemented buffer can maintain stability for up to 12 months at -80°C, with activity retention above 85% compared to fresh preparations.

What expression systems are most effective for producing recombinant YPK_2050?

The expression of membrane proteins like YPK_2050 presents unique challenges compared to soluble proteins. Based on research experience, several expression systems have been evaluated:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli BL21(DE3)Cost-effective, rapid growthInclusion body formation0.5-2.0
Y. pseudotuberculosisNative folding, post-translational modificationsLower yields, pathogen containment0.2-0.8
Insect cell systemBetter membrane protein foldingHigher cost, longer production time1.0-3.0

For YPK_2050, recombinant expression in modified Y. pseudotuberculosis strains has shown promising results, particularly when using gene deletion mutants such as ΔLpxL that reduce toxicity . When expressing membrane proteins, consider using specialized E. coli strains (C41/C43) with T7 promoter systems under control of lower IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-25°C) during induction.

How can Design of Experiments (DoE) improve YPK_2050 recombinant protein production?

Design of Experiments offers a systematic approach to optimize YPK_2050 production, replacing inefficient one-factor-at-a-time methods . For membrane protein expression, DoE can simultaneously evaluate multiple factors affecting production:

  • Implement factorial design to examine interactions between critical factors:

    • Induction temperature (16°C, 25°C, 30°C)

    • Inducer concentration (0.1mM, 0.5mM, 1.0mM IPTG)

    • Media composition (variations in nitrogen sources, carbon sources)

    • Harvest time (4h, 8h, 16h post-induction)

  • Apply response surface methodology (RSM) to identify optimal conditions:

    • Create mathematical models predicting protein yield based on experimental data

    • Generate response surface plots visualizing factor interactions

    • Identify optimal factor combinations for maximum expression

  • Use software packages for efficient analysis:

    • Design-Expert, JMP, or Minitab for experiment design and statistical analysis

    • Apply central composite or Box-Behnken designs for response surface methods

This approach with YPK_2050 typically reduces experimental runs by 60-70% compared to traditional methods while providing more robust outcomes with statistical confidence. For instance, DoE optimization for a similar membrane protein increased yields from 0.8 mg/L to 3.2 mg/L through identification of optimal temperature (18°C), IPTG concentration (0.2 mM), and post-induction time (16h).

What purification strategies are most effective for YPK_2050?

Purifying membrane proteins like YPK_2050 requires specialized approaches:

  • Membrane extraction and solubilization:

    • Extract membranes using ultracentrifugation (120,000 × g, 4°C for 2 hours)

    • Test multiple detergents for solubilization (DDM, LDAO, OG at 0.5-2% concentrations)

    • Optimize detergent:protein ratio for maximum solubilization without denaturation

  • Chromatographic purification strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing step: Size exclusion chromatography

    • Buffer composition: Maintain detergent above critical micelle concentration (CMC)

  • Quality assessment:

    • SDS-PAGE and Western blot for purity and identity confirmation

    • Dynamic light scattering for aggregation analysis

    • Circular dichroism for secondary structure verification

A successful purification protocol for YPK_2050 typically yields 0.5-1.5 mg of >90% pure protein per liter of culture, with retention of native membrane protein folding as confirmed by circular dichroism.

How can YPK_2050 be incorporated into outer membrane vesicles (OMVs) for vaccine development?

Incorporating YPK_2050 into OMVs represents an innovative vaccine delivery approach:

  • Construction of recombinant expression strains:

    • Design expression vectors containing YPK_2050 with appropriate promoters

    • Create gene deletion mutants (e.g., ΔLpxL strains) to reduce vesicle toxicity

    • Transform plasmids into Y. pseudotuberculosis using electroporation

  • OMV isolation and purification:

    • Grow bacterial cultures to logarithmic phase (OD600 0.4-0.6)

    • Add EDTA (0.5M) to stimulate OMV production and incubate on ice for 1 hour

    • Remove bacteria by centrifugation (10,000 × g, 15 min) and filtration (0.22-μm)

    • Concentrate using tangential flow filtration

    • Isolate OMVs via ultracentrifugation (120,000 × g, 4°C, 2 hours)

    • Resuspend in sterile buffer (typically 1/10× PBS)

  • Verification of YPK_2050 incorporation:

    • Confirm protein presence via SDS-PAGE and Western blotting

    • Quantify protein expression levels using ImageJ analysis (target: 3-6% of total OMV protein)

    • Characterize OMV size distribution using dynamic light scattering

    • Assess subcellular localization through proteomics analysis

Research has shown that recombinant OMVs containing membrane proteins can elicit balanced Th1/Th2 immune responses with significant production of IgM and IgA antibodies . Expression levels of target proteins in OMVs typically range from 3-7% of total vesicle protein content, with vesicle size distributions of 50-150 nm.

What immunological assays are appropriate for evaluating YPK_2050-containing constructs?

Comprehensive immunological evaluation requires multiple assay systems:

  • Antibody response characterization:

    • ELISA for detection of specific antibody isotypes (IgG, IgG1, IgG2a, IgM, IgA)

    • Western blot for confirmation of antibody specificity

    • Flow cytometry for B-cell population analysis

  • Cellular immune response assessment:

    • Cytokine profiling (IFN-γ, IL-1β, IL-17A, IL-6, TNF-α) via ELISA

    • ELISpot for quantification of cytokine-producing cells

    • T-cell proliferation assays using CFSE labeling

  • Protective efficacy evaluation:

    • Challenge models with relevant pathogens

    • Bacterial burden assessment in target tissues

    • Survival rate analysis following challenge

In immunization studies, proper controls should include adjuvant-only groups, non-recombinant OMV controls, and purified protein with conventional adjuvants. Immunization schedules typically involve prime-boost regimens (e.g., day 0 and day 21) with assessment of immune responses 14-28 days post-immunization .

What bioinformatic approaches are useful for analyzing YPK_2050 function?

Computational analysis provides valuable insights into YPK_2050 function:

  • Sequence-based analysis:

    • Homology searches against protein databases using BLAST and HMMer

    • Multiple sequence alignment with homologs from related Yersinia species

    • Identification of conserved domains and motifs using InterPro and PFAM

  • Structural prediction:

    • Transmembrane topology prediction using TMHMM or Phobius

    • Ab initio structural modeling with AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to assess membrane interactions

  • Functional prediction:

    • Protein-protein interaction network analysis

    • Gene neighborhood and genomic context examination

    • Comparative genomics across pathogenic and non-pathogenic strains

  • Subcellular localization:

    • SignalP for signal peptide prediction

    • Gneg-mPLoc for Gram-negative bacterial protein localization

    • PSORTb for comprehensive localization prediction

These approaches can generate testable hypotheses about YPK_2050 function, which can then be verified through experimental approaches such as gene knockout studies, protein interaction assays, or localization microscopy.

How can protein degradation issues with YPK_2050 be addressed during purification?

Membrane protein degradation during purification requires systematic troubleshooting:

  • Protease inhibition strategy:

    • Incorporate complete protease inhibitor cocktails immediately after cell lysis

    • Add specific inhibitors (PMSF, EDTA, leupeptin, pepstatin A)

    • Maintain samples at 4°C throughout purification

    • Consider using protease-deficient expression strains

  • Buffer optimization:

    • Test multiple pH conditions (range 6.0-8.5) to determine optimal stability

    • Add stabilizing agents (glycerol 10-20%, sucrose 5-10%)

    • Include reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

    • Test different detergent types and concentrations

  • Purification strategy adjustments:

    • Minimize purification duration by optimizing protocols

    • Evaluate impact of different chromatography matrices on protein stability

    • Consider on-column digestion of fusion tags to reduce exposure time

    • Implement quality control at each step to identify degradation onset

When faced with persistent degradation, consider alternative expression approaches such as cell-free systems or inclusion body formation followed by refolding, which may circumvent proteolysis issues in certain cases.

What strategies can resolve poor expression yields of YPK_2050?

Improving YPK_2050 expression requires a multi-faceted approach:

  • Genetic optimization:

    • Codon optimization for expression host

    • Use of stronger or inducible promoters

    • Incorporation of fusion partners (MBP, SUMO, Trx) to enhance solubility

    • Evaluation of expression with and without signal sequences

  • Host strain selection:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Consider homologous expression in Yersinia pseudotuberculosis

    • Evaluate eukaryotic systems for complex membrane proteins

  • Culture condition optimization using DoE approach:

    • Systematically test induction timing, temperature, and inducer concentration

    • Evaluate media composition effects (defined vs. complex media)

    • Optimize oxygen transfer and mixing in culture vessels

  • Protein engineering:

    • Express functional domains rather than full-length protein

    • Create chimeric constructs with well-expressed membrane proteins

    • Introduce stabilizing mutations based on computational prediction

Implementation of these strategies has been shown to increase recombinant membrane protein yields by 5-10 fold in challenging cases, often transforming non-expressing systems into viable production platforms.

How might YPK_2050 be utilized in developing novel antimicrobial strategies?

YPK_2050's role as a membrane protein positions it as a potential target for antimicrobial development:

  • Target validation approaches:

    • Gene deletion studies to assess essentiality for bacterial viability

    • Conditional knockdown systems to evaluate phenotypic effects

    • Overexpression studies to identify potential toxic or growth-inhibitory effects

  • Drug discovery methodologies:

    • High-throughput screening against purified YPK_2050

    • Structure-based drug design following crystallographic studies

    • Peptide inhibitor development targeting accessible regions

    • Antibody-based approaches for extracellular epitopes

  • Novel vaccine approaches:

    • OMV-based vaccines incorporating YPK_2050 with immunostimulatory antigens

    • DNA vaccine constructs encoding YPK_2050

    • Epitope mapping to identify immunodominant regions

  • Diagnostic applications:

    • Development of YPK_2050-specific antibodies for Yersinia detection

    • PCR-based detection of YPK_2050 gene for species identification

    • Biosensor development using YPK_2050-binding molecules

The exploration of these avenues represents promising directions for translating basic YPK_2050 research into practical applications for controlling Yersinia infections and potentially other related bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.