Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0283 membrane protein YPK_1899 (YPK_1899)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
YPK_1899; UPF0283 membrane protein YPK_1899
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Target Names
YPK_1899
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links

KEGG: ypy:YPK_1899

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of the YPK_1899 membrane protein in Yersinia pseudotuberculosis?

The YPK_1899 membrane protein belongs to the UPF0283 family of proteins with poorly characterized functions in Y. pseudotuberculosis. Current research suggests it may play a role in bacterial envelope integrity and potentially interacts with extracytoplasmic stress response mechanisms like the CpxA-CpxR two-component regulatory system. This system is known to be activated during bacterial envelope stress and regulates factors that maintain envelope integrity while also influencing virulence gene expression . Methodologically, researchers investigate its function through gene deletion studies, protein-protein interaction assays, and transcriptional analysis to observe phenotypic changes in bacterial survival and virulence.

How does YPK_1899 expression change during different growth phases and environmental conditions?

YPK_1899 expression patterns likely vary depending on growth conditions and environmental stressors. Similar to other membrane proteins in Y. pseudotuberculosis, its expression may be regulated by temperature, nutrient availability, and host environment signals. The expression of many virulence-associated genes in Y. pseudotuberculosis is temperature-dependent, with different regulation patterns observed at 15°C versus 37°C . To study these changes, researchers typically employ qRT-PCR under various growth conditions, reporter gene fusions, and proteomics approaches to quantify changes in protein abundance across different environmental conditions.

What is the subcellular localization pattern of YPK_1899 in Y. pseudotuberculosis?

As a UPF0283 membrane protein, YPK_1899 is predicted to be localized in the bacterial membrane, though its precise orientation and topology require experimental verification. Researchers typically employ several complementary methods to determine subcellular localization, including:

  • Fractionation studies with Western blot analysis

  • Fluorescent protein fusion microscopy

  • Immunogold electron microscopy

  • Protease accessibility assays to determine protein topology

  • Computational prediction tools to identify transmembrane domains

These approaches collectively provide insights into whether the protein spans the membrane once or multiple times, and which domains face the periplasm versus the cytoplasm.

How does YPK_1899 interact with the CpxA-CpxR two-component system in regulating virulence?

The potential interaction between YPK_1899 and the CpxA-CpxR system represents an important research area. The CpxA-CpxR system in Y. pseudotuberculosis responds to envelope stress by upregulating factors that maintain envelope integrity while downregulating virulence genes like inv, rovA, and components of the Ysc-Yop Type III secretion system . To investigate whether YPK_1899 functions within this regulatory network, researchers could employ:

  • Bacterial two-hybrid assays (BACTH) to detect protein-protein interactions between YPK_1899 and CpxA or CpxR

  • Co-immunoprecipitation studies followed by mass spectrometry

  • Transcriptional analysis of ypk_1899 in wild-type vs. cpxA/cpxR mutant backgrounds

  • Epistasis analysis comparing phenotypes of single and double mutants

  • Chromatin immunoprecipitation (ChIP) to determine if CpxR~P binds to the ypk_1899 promoter region

Understanding this interaction could reveal novel mechanisms in how Y. pseudotuberculosis coordinates virulence regulation in response to environmental signals.

What is the role of YPK_1899 in the context of the bacterial envelope stress response?

Given that membrane proteins often function in maintaining envelope integrity, YPK_1899 may participate in the bacterial stress response. In Y. pseudotuberculosis, the CpxA-CpxR system upregulates genes like cpxP, degP, and ppiA that are involved in protein quality control in the periplasm . To investigate YPK_1899's role in this context:

  • Create a ypk_1899 deletion mutant and assess its sensitivity to various envelope stressors (detergents, antimicrobial peptides, osmotic stress)

  • Perform transcriptome analysis comparing wild-type and mutant strains under stress conditions

  • Measure activation of stress response pathways in the presence/absence of YPK_1899

  • Assess envelope integrity through permeability assays and electron microscopy

  • Determine if YPK_1899 interacts with other known envelope stress proteins through protein-protein interaction studies

These approaches would help establish whether YPK_1899 functions as a sensor, effector, or modulator in envelope stress response pathways.

How does YPK_1899 contribute to Y. pseudotuberculosis pathogenesis in different infection models?

Understanding the contribution of YPK_1899 to pathogenesis requires comparative analysis in various infection models. Y. pseudotuberculosis typically enters the host through contaminated food and water, surviving acidic conditions in the stomach before reaching the small intestine and targeting M cells .

Methods to investigate YPK_1899's role in pathogenesis include:

  • In vitro infection models using epithelial cells, M cells, and macrophages

  • Comparing wild-type and ypk_1899 mutant strains for adhesion, invasion, and intracellular survival

  • Mouse infection models to assess bacterial colonization of Peyer's patches, mesenteric lymph nodes, liver, and spleen

  • Competitive index assays comparing wild-type and mutant strains in vivo

  • Transcriptional profiling of ypk_1899 during different stages of infection

These approaches would help determine at which stage of infection YPK_1899 plays the most significant role and how it contributes to Y. pseudotuberculosis virulence.

What are the optimal conditions for expressing and purifying recombinant YPK_1899 protein?

Expressing and purifying membrane proteins like YPK_1899 presents significant technical challenges. A methodological approach would include:

  • Expression system selection:

    • E. coli-based systems (BL21, C41/C43 strains designed for membrane proteins)

    • Cell-free expression systems

    • Yeast expression systems for eukaryotic-like folding

  • Optimization parameters:

    • Induction conditions (temperature, inducer concentration, duration)

    • Growth media composition

    • Codon optimization for the expression host

  • Purification strategy:

    • Detergent selection for membrane protein solubilization

    • Affinity chromatography (His-tag, GST-tag)

    • Size exclusion chromatography for final purification

  • Quality control:

    • Western blot analysis

    • Circular dichroism to assess secondary structure

    • Mass spectrometry to confirm protein identity

The choice between these approaches depends on the downstream applications for the purified protein, with structural studies requiring the highest purity and native conformation.

How can researchers effectively generate and validate ypk_1899 deletion mutants in Y. pseudotuberculosis?

Creating clean deletion mutants requires careful methodological approaches:

  • Mutant construction:

    • Suicide vector-based systems like pDM4 for allelic exchange

    • Lambda Red recombination system adapted for Yersinia

    • CRISPR-Cas9 genome editing approaches

  • Selection strategy:

    • Antibiotic resistance markers with subsequent removal

    • Counter-selection markers (sacB, rpsL)

    • Screening PCR to identify successful deletions

  • Validation approaches:

    • RT-PCR and Western blotting to confirm absence of transcript and protein

    • Whole genome sequencing to rule out off-target effects

    • Complementation studies to verify phenotypes are due to the specific deletion

    • Polar effect analysis on neighboring genes

  • Phenotypic characterization:

    • Growth curves under various conditions

    • Stress response assays

    • Virulence-associated phenotypes

This systematic approach ensures that observed phenotypes can be confidently attributed to the absence of YPK_1899 rather than unintended genetic alterations.

What techniques are most effective for studying YPK_1899 interactions with other cellular components?

Investigating protein interactions requires multiple complementary approaches:

TechniqueApplicationAdvantagesLimitations
Bacterial Two-Hybrid (BACTH)In vivo detection of binary protein interactionsWorks well for membrane proteins, can be performed in bacterial systemsMay give false positives/negatives
Co-immunoprecipitationPhysical isolation of protein complexesCaptures native interactionsRequires good antibodies, transient interactions may be missed
Pull-down assaysIn vitro validation of interactionsCan control binding conditionsArtificial environment may not reflect in vivo reality
Cross-linking Mass SpectrometryIdentification of interaction interfacesProvides structural insights into complexesTechnical complexity, requires specialized equipment
Fluorescence Resonance Energy Transfer (FRET)In vivo visualization of protein proximityReal-time monitoring in living cellsRequires fluorescent protein fusions which may alter function
Surface Plasmon ResonanceQuantitative binding kineticsProvides kon/koff ratesRequires purified proteins

Researchers should employ at least two independent methods to confirm interactions, as each technique has its own biases and limitations.

How should researchers address contradictory findings about YPK_1899 function across different experimental systems?

When confronting contradictory data about YPK_1899 function, researchers should:

Similar ambiguities have been observed with other Y. pseudotuberculosis proteins like YmoA, which shows different stability at 37°C between Y. enterocolitica and Y. pseudotuberculosis .

What are the key considerations when interpreting transcriptomic data related to YPK_1899 expression?

When analyzing transcriptomic data for YPK_1899, researchers should consider:

  • Experimental design factors:

    • Growth phase effects (log phase vs. stationary phase)

    • Media composition effects on gene expression

    • Temperature-dependent regulation (known to affect many virulence genes)

    • Host-induced changes vs. in vitro conditions

  • Technical considerations:

    • RNA isolation methods appropriate for bacterial samples

    • Platform-specific biases (microarray vs. RNA-seq)

    • Normalization procedures and reference genes selection

    • Batch effects and technical variability

  • Biological interpretation frameworks:

    • Integration with regulon data (e.g., CpxR regulon)

    • Pathway analysis to identify functional implications

    • Comparison with other Yersinia species for evolutionary insights

  • Validation requirements:

    • qRT-PCR confirmation of key findings

    • Protein-level validation through proteomics or Western blotting

    • Functional validation through phenotypic assays

Y. pseudotuberculosis shows complex transcriptional regulation patterns for virulence genes in response to environmental signals, as seen with the RovA-RovM regulatory cascade , making careful interpretation essential.

How might YPK_1899 function be explored in the context of host-pathogen interactions?

Future research on YPK_1899's role in host-pathogen interactions could include:

  • Host cell response studies:

    • Transcriptomics/proteomics of host cells infected with wild-type vs. ypk_1899 mutants

    • Assessment of inflammasome activation and cytokine production

    • Electron microscopy to examine bacterial-host membrane interactions

  • Advanced infection models:

    • Organoid systems to model intestinal infection

    • Tissue-specific conditional knockout mice to assess host factors

    • In vivo imaging to track bacterial dissemination patterns

  • Interspecies comparative analysis:

    • Functional comparison with homologs in Y. pestis

    • Evolutionary analysis across Yersinia species

    • Identification of host-specific adaptations

  • Novel therapeutic targeting approaches:

    • Epitope mapping to identify immunogenic regions

    • Structure-based drug design if structural data becomes available

    • Assessment as a potential vaccine candidate

Understanding YPK_1899 in host-pathogen contexts may reveal new insights into how Y. pseudotuberculosis adapts to different host environments during infection progression.

What emerging technologies could advance our understanding of YPK_1899 structural biology?

Cutting-edge approaches for structural studies of YPK_1899 include:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure determination

    • Tomography to visualize protein in native membrane context

    • In situ structural studies within bacterial cells

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to identify domain arrangements

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Advanced computational methods:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Molecular dynamics simulations in membrane environments

    • Machine learning approaches for function prediction from structure

  • Nanodiscs and membrane mimetics:

    • Novel systems for stabilizing membrane proteins

    • Lipid-specific interactions studies

    • Native mass spectrometry of membrane protein complexes

These technologies could reveal how YPK_1899 is oriented in the membrane, potential conformational changes, and molecular mechanisms of its function in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.