Recombinant Yop proteins translocation lipoprotein J (yscJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize development accordingly.
Synonyms
yscJ; lcrKA; ylpB; pYV0086; Yop proteins translocation lipoprotein J; Lipoprotein YlpB; Low calcium response locus protein KA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-244
Protein Length
Full Length of Mature Protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
yscJ
Target Protein Sequence
CKVDLYTGISQKEGNEMLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYP HESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSH LPRNTSILSIQVSEESKGHLIGLLSLLILLLPVTNLAQYFWLQRKK
Uniprot No.

Target Background

Function
Essential for the export of Yop proteins.
Database Links

KEGG: yps:pYV0086

Protein Families
YscJ lipoprotein family
Subcellular Location
Cell outer membrane; Lipid-anchor.

Q&A

What is the functional role of YscJ in the Yersinia type III secretion system?

YscJ is a bacterial lipoprotein that serves as an essential structural component of the type III secretion system in Yersinia species. Experimental evidence demonstrates that YscJ is absolutely required for the secretion of the V antigen and Yop proteins from the bacterial cytoplasm. Mutational studies specifically show that yscJ deletion mutants fail to secrete YopE and other Yop proteins regardless of calcium concentration or temperature conditions, indicating its fundamental role in the secretion apparatus .

Research approaches to investigate YscJ function typically involve creating in-frame deletion mutants followed by complementation studies using plasmid-expressed YscJ. The secretion phenotype can be assessed through SDS-PAGE and immunoblot analysis of culture supernatants, specifically looking for the presence or absence of Yop proteins and V antigen under secretion-inducing conditions (37°C in the absence of calcium) .

How do YscJ and other Ysc proteins interact to form a functional type III secretion apparatus?

The type III secretion apparatus in Yersinia consists of numerous protein components that assemble into a multi-subunit structure spanning the bacterial inner and outer membranes. YscJ is believed to form part of the basal body complex that anchors the secretion system in the bacterial envelope. The functional assembly requires coordinated interactions with other Ysc proteins including YscN (the putative energizer of the system), YscX, and YscY .

To study these protein-protein interactions, researchers commonly employ techniques such as:

  • Yeast two-hybrid analysis to detect direct protein interactions

  • Co-immunoprecipitation studies using epitope-tagged proteins

  • Bacterial two-hybrid systems optimized for membrane protein interactions

  • Cross-linking experiments followed by mass spectrometry to identify interaction partners

What experimental approaches can determine the localization of YscJ within bacterial cells?

Understanding the precise subcellular localization of YscJ is crucial for elucidating its role in T3SS assembly. Research methodologies to investigate YscJ localization include:

  • Fractionation studies separating bacterial cell pellet from culture supernatant

  • Membrane fractionation to distinguish inner and outer membrane localization

  • Immunoelectron microscopy using gold-labeled antibodies against YscJ

  • Fluorescence microscopy using GFP-tagged YscJ constructs

Evidence from similar studies with other Ysc proteins shows that proper subcellular localization can be determined by examining fractions from bacterial cultures grown under both secretion-permissive and non-permissive conditions. For instance, YscX has been found in both the cell pellet fraction and the culture supernatant, while YscY appears to remain exclusively in the cell pellet fraction .

How does the lipid modification of YscJ contribute to type III secretion system assembly and function?

YscJ belongs to the family of bacterial lipoproteins, which undergo post-translational lipid modification at an N-terminal cysteine residue following cleavage of a signal peptide. This lipid modification anchors YscJ to the bacterial membrane, which is critical for its function in the type III secretion apparatus.

To investigate the importance of lipid modification for YscJ function, researchers can:

  • Generate site-directed mutants altering the lipobox sequence (including the critical cysteine residue)

  • Employ metabolic labeling with radiolabeled fatty acids to confirm lipidation status

  • Analyze membrane association through ultracentrifugation and detergent extraction methods

  • Perform complementation assays with lipidation-defective YscJ mutants to assess functional consequences

Preliminary findings suggest that proper membrane anchoring of YscJ through lipid modification is essential for the assembly of a functional type III secretion apparatus, as it may serve to properly position the secretion machinery within the bacterial envelope.

What is the relationship between YscJ and the secretion signals required for Yop protein export?

The targeting of proteins for export through the type III secretion apparatus involves specific secretion signals. Research has identified two distinct secretion targeting signals in Yop proteins :

  • An mRNA-based signal within sequences encoding the initial 15 amino acid residues

  • A protein-based signal dependent on interaction with specific Yop chaperones (Syc proteins)

Table 1: Identified Type III Secretion Signals in Yersinia

ProteinmRNA Signal (N-terminal 15 aa)Chaperone-Dependent SignalChaperone
YopEYesYesSycE
YopHNot determinedYesSycH
YopNYesYesSycN/YscB
YopTNot determinedYesSycT
YopB/DNot determinedYesSycD
YscXLikely presentYesYscY

To study how YscJ interfaces with these secretion signals, researchers can:

  • Analyze the secretion of reporter constructs containing various secretion signals in wild-type versus yscJ mutant backgrounds

  • Perform protein-protein interaction studies between YscJ and components of the targeting machinery

  • Investigate the dynamics of protein export using pulse-chase experiments in various genetic backgrounds

What structural features of YscJ enable its assembly into the type III secretion apparatus ring structure?

YscJ is predicted to form a ring-like structure as part of the type III secretion system basal body. Advanced structural biology approaches to investigate this include:

  • X-ray crystallography of purified recombinant YscJ

  • Cryo-electron microscopy of isolated secretion system complexes

  • Site-directed mutagenesis of predicted oligomerization domains

  • In vitro reconstitution of YscJ ring structures

Research should focus on identifying specific domains involved in protein-protein interactions that facilitate ring formation, particularly regions that might interact with other basal body components.

What are the optimal conditions for expressing and purifying recombinant YscJ protein?

Efficient expression and purification of recombinant YscJ presents challenges due to its membrane-associated nature. Recommended methodological approaches include:

  • Expression system selection:

    • E. coli-based systems using T7 or tac promoters

    • Cell-free expression systems for membrane proteins

    • Yeast expression systems for proper lipid modification

  • Solubilization strategies:

    • Detergent screening (DDM, LDAO, OG) for optimal extraction

    • Lipid nanodisc incorporation for maintaining native structure

    • Fusion partners (MBP, SUMO) to enhance solubility

  • Purification protocol:

    • IMAC using His-tagged constructs under denaturing or native conditions

    • Size exclusion chromatography for oligomeric state determination

    • Affinity chromatography using anti-YscJ antibodies

  • Quality control assessments:

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering for homogeneity analysis

    • Functional reconstitution assays where applicable

How can researchers effectively analyze the interaction between YscJ and other components of the type III secretion system?

Understanding protein-protein interactions within the type III secretion apparatus is critical for elucidating the molecular mechanisms of Yop protein translocation. Recommended methodological approaches include:

  • Yeast two-hybrid analysis:
    Similar to studies conducted with YscX and YscY, researchers can use GAL4 activation and DNA binding domain fusions to detect interactions between YscJ and other Ysc proteins . This approach has successfully identified interactions between YscY and YscX, revealing functional relationships.

  • Protein affinity blotting:
    FLAG-tagged YscJ can be used to probe immobilized potential interaction partners transferred to nitrocellulose membranes. This technique has demonstrated specific binding between YscY and YscX and could be adapted to study YscJ interactions .

  • Co-immunoprecipitation studies:
    Using epitope-tagged versions of YscJ and potential interaction partners, researchers can perform pull-down assays followed by immunoblotting to detect specific interactions under native conditions.

  • Surface plasmon resonance:
    For quantitative analysis of binding kinetics, purified YscJ can be immobilized on a sensor chip and binding to other purified Ysc proteins can be measured in real-time.

What genetic approaches can be used to study YscJ function in the context of whole bacterial cells?

Genetic manipulation provides powerful tools for investigating YscJ function in vivo. Methodological approaches include:

  • Construction of in-frame deletion mutants:
    Following the approach used for yscX and yscY deletion mutants, researchers can create precise deletions in the yscJ gene using allelic exchange techniques . This involves:

    • PCR amplification of flanking regions

    • Overlap extension PCR to create the deletion construct

    • Cloning into a suicide vector (e.g., pCVD442)

    • Selection for double crossover events

  • Complementation analysis:
    To confirm phenotypes are specifically due to yscJ deletion, researchers should perform complementation studies using:

    • Plasmid-based expression of wild-type YscJ

    • Site-directed mutagenesis to create point mutations in functional domains

    • Controlled expression systems (e.g., arabinose-inducible promoters)

  • Reporter gene fusions:
    To study yscJ expression and regulation, researchers can generate:

    • Transcriptional fusions to lacZ or gfp

    • Translational fusions that maintain YscJ functionality

    • Dual reporter systems to monitor both expression and secretion

How does YscJ contribute to Yersinia virulence during infection of eukaryotic cells?

YscJ is essential for the functional assembly of the type III secretion system, which in turn is required for the translocation of Yop virulence proteins into host cells. To study the role of YscJ in host-pathogen interactions, researchers can employ:

  • Infection models using cultured mammalian cells:

    • HeLa cells, macrophages, or dendritic cells

    • Measurement of Yop translocation efficiency using reporter-tagged Yops

    • Assessment of cytotoxic effects (cell rounding, cytoskeletal disruption)

    • Analysis of host cell signaling pathway modulation

  • Animal infection models:

    • Mouse models of Yersinia infection

    • Competitive index assays comparing wild-type and yscJ mutant strains

    • Histopathological analysis of infected tissues

    • Immune response monitoring (cytokine production, neutrophil recruitment)

The functional consequences of YscJ deficiency would manifest as an inability to deliver Yop proteins into host cells, resulting in:

  • Failure to inhibit phagocytosis

  • Inability to suppress pro-inflammatory cytokine production

  • Reduced bacterial survival in host tissues

  • Attenuated virulence in animal models

What techniques can be used to visualize YscJ during the process of type III secretion system assembly?

Advanced imaging techniques can provide insights into the dynamics of YscJ localization and function during T3SS assembly:

  • Super-resolution microscopy:

    • PALM or STORM imaging of fluorescently tagged YscJ

    • Dual-color imaging to visualize co-localization with other T3SS components

    • Time-lapse imaging to monitor assembly dynamics

  • Correlative light and electron microscopy:

    • Combining fluorescence microscopy with transmission electron microscopy

    • Immunogold labeling for precise localization at ultrastructural level

    • Electron tomography for 3D reconstruction of the secretion apparatus

  • Atomic force microscopy:

    • Visualization of purified YscJ complexes

    • Analysis of conformational changes under different conditions

    • Force measurements to assess structural stability

How can researchers quantitatively assess the impact of YscJ mutations on Yop protein translocation efficiency?

To measure the functional consequences of YscJ mutations on T3SS activity, researchers can employ various quantitative assays:

  • β-lactamase reporter system:

    • Fusion of TEM-1 β-lactamase to Yop proteins

    • Loading of host cells with CCF2/AM fluorescent substrate

    • Measurement of substrate cleavage as indication of translocation

    • Flow cytometry or plate reader-based quantification

  • Adenylate cyclase (CyaA) fusion assay:

    • Fusion of Bordetella pertussis CyaA to Yop proteins

    • Measurement of cAMP production in host cells

    • Enzyme-linked immunosorbent assay (ELISA) for cAMP

  • Immunoblot-based quantification:

    • Selective lysis of host cells after infection

    • Quantitative immunoblotting of translocated Yops

    • Normalization to bacterial attachment levels

  • Luciferase reporter systems:

    • Split luciferase complementation assays

    • Bioluminescence measurement as indication of successful translocation

What mechanisms regulate YscJ expression and incorporation into the type III secretion apparatus?

Understanding the regulatory networks controlling YscJ expression provides insights into T3SS assembly. Research approaches include:

  • Transcriptional regulation analysis:

    • Promoter mapping using 5' RACE

    • Reporter gene fusions to identify regulatory elements

    • Chromatin immunoprecipitation to identify transcription factor binding

    • RNA-seq to measure expression under various conditions

  • Post-transcriptional regulation:

    • Analysis of mRNA stability and degradation kinetics

    • Identification of sRNAs affecting yscJ expression

    • Assessment of translational efficiency using ribosome profiling

  • Post-translational regulation:

    • Protein stability studies using pulse-chase experiments

    • Identification of proteases involved in YscJ turnover

    • Analysis of modification states (phosphorylation, lipidation)

How has YscJ evolved among different Yersinia species and other bacteria with type III secretion systems?

Evolutionary analysis of YscJ provides insights into its structural and functional conservation. Research approaches include:

  • Comparative genomics:

    • Sequence alignment of YscJ homologs across bacterial species

    • Identification of conserved domains and critical residues

    • Analysis of genomic context and operon structure

  • Phylogenetic analysis:

    • Construction of phylogenetic trees based on YscJ sequences

    • Correlation with bacterial pathogenicity

    • Detection of selective pressure using dN/dS ratio analysis

  • Functional complementation studies:

    • Cross-species complementation with YscJ homologs

    • Chimeric protein analysis to identify functional domains

    • Heterologous expression to assess functional conservation

Table 2: YscJ Homologs in Different Bacterial Type III Secretion Systems

Bacterial SpeciesYscJ HomologSequence Identity (%)System Function
Yersinia pestisYscJ100Anti-phagocytic
Yersinia enterocoliticaYscJ~90Anti-phagocytic
Pseudomonas aeruginosaPscJ~60Cytotoxicity
Salmonella entericaPrgK~55Invasion
Shigella flexneriMxiJ~50Invasion
E. coli (EPEC)EscJ~45Attachment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.