Recombinant Yop proteins translocation protein U (yscU)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Yop Proteins Translocation Protein U (yscU)

The Yersinia outer protein U (yscU) is a critical component of the type III secretion system (T3SS) in Yersinia species, enabling the translocation of virulence factors (Yops) into host cells. As a translocation protein, yscU regulates substrate specificity, switching secretion from needle components (e.g., YscF) to effector Yops (e.g., YopE, YopH) during infection . Recombinant yscU is produced in E. coli and used in research to study T3SS regulation, pathogenicity, and therapeutic target development .

Substrate Specificity Switching

YscU and YscP coordinately regulate T3SS activity:

  1. Early Phase: YscF (needle component) secretion dominates.

  2. Late Phase: Autoproteolysis of yscU releases YscU_CC, triggering Yop secretion .

  3. Regulation: YscP binds yscU’s cytosolic domain, stabilizing needle assembly and enabling Yop export .

Key Mutant Phenotypes

MutationEffect on SecretionReference
yscP nullOverproduces YscF, fails to secrete Yops
yscU cytoplasmicSuppresses yscP mutant; restores Yop secretion
yscU autoproteolysis-defectiveBlocks Yop secretion, retains YscF

Autoproteolysis and Secretion

  • Calcium Depletion: Triggers intramolecular dissociation of YscU_CC, which is secreted via the T3SS .

  • YscU_CC Function: Acts as a signal for substrate switching, mimicking Yop secretion properties .

Interaction with YscP

  • Structural Basis: YscP binds yscU’s cytosolic domain, promoting needle assembly and Yop secretion .

  • Suppression Mutants: Mutations in yscU’s cytoplasmic domain restore Yop secretion in yscP mutants, confirming their cooperative role .

Role in Pathogenicity

  • YopD Translocation: yscU mutants impair YopD secretion, disrupting pore formation in host cells .

  • Inhibitor Screening: Small-molecule inhibitors targeting T3SS block Yop translocation without affecting secretion .

Experimental Insights

  • ELISA Kits: Detect yscU in research settings, aiding studies on T3SS regulation .

  • Mutagenesis Studies: Site-directed mutations in yscU’s cytoplasmic domain reveal domains critical for Yop secretion .

Future Directions and Therapeutic Potential

  • Targeting yscU: Small-molecule inhibitors disrupting yscU autoproteolysis or YscP interaction could block Yop translocation .

  • Structural Studies: Resolving yscU’s 3D structure could elucidate its interaction with YscP and YscI (inner rod protein) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type requirement. We will prioritize developing the specified tag if possible.
Synonyms
yscU; YPCD1.47; y5031; y0034; YP_pCD36; Yop proteins translocation protein U
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Yersinia pestis
Target Names
yscU
Target Protein Sequence
MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML
Uniprot No.

Target Background

Function
YscU is a component of the Yop secretion machinery.
Database Links

KEGG: ype:YPCD1.47

Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of YscU in the type III secretion system of Yersinia?

YscU functions as a critical inner membrane protein that coordinates with YscP to regulate substrate specificity in the Yersinia type III secretion system. Research demonstrates that YscU is particularly important for controlling which proteins (YscF needle components versus Yop effectors) are secreted through the T3SS apparatus. Mutations in the cytoplasmic domain of YscU can significantly alter the secretion profile of the system, particularly by suppressing yscP mutant phenotypes. This regulatory function involves reducing YscF secretion (needle component) while increasing Yop effector secretion, suggesting a molecular switch mechanism that controls the secretion hierarchy .

For researchers beginning work in this area, standard molecular cloning approaches using PCR amplification of the yscU gene can be implemented. According to established protocols, yscU can be amplified using DNA polymerase and appropriate primer pairs, followed by restriction digestion and cloning into vectors such as pKK223-3, placing the gene under control of IPTG-inducible promoters for experimental manipulation .

How are secretion signals characterized in Yop proteins?

The secretion signals of Yop proteins are typically characterized using gene fusion approaches. For YopN specifically, the minimal secretion signal is encoded by codons 1-12, which is sufficient to direct the type III secretion of fused reporter proteins. Experimental approaches involve creating hybrid proteins by fusing portions of the yopN coding sequence to reporter genes like npt (neomycin phosphotransferase) or bla (β-lactamase) .

To study these signals, researchers should follow these methodological steps:

  • Generate hybrid proteins containing the Yop protein promoter, upstream untranslated mRNA sequence, and varying lengths of coding sequence

  • Fuse these elements to reporter proteins (e.g., Npt)

  • Clone gene sequences on appropriate plasmids (e.g., low-copy-number plasmid pHSG576)

  • Transform recombinant plasmids into Yersinia enterocolitica

  • Induce type III secretion by temperature shift to 37°C

  • Separate bacteria from culture supernatants by centrifugation

  • Analyze cellular and secreted protein fractions by immunoblotting with specific antibodies

What experimental systems can be used to study Yop protein translocation into host cells?

The β-lactamase reporter system provides a direct and effective assay for studying the translocation of Yop effectors into eukaryotic cells. This methodology involves constructing fusion proteins containing Yop protein secretion signals (such as the first 99 amino acids of YopH) and β-lactamase lacking its N-terminal secretion signal sequence .

For implementing this system, researchers should:

  • Design fusion constructs containing Yop translocation domains and reporter proteins

  • Express these constructs in Yersinia strains capable of T3SS-dependent translocation

  • Co-culture the bacteria with target eukaryotic cells

  • Use β-lactamase activity assays (typically fluorescence-based) to detect and quantify protein translocation

  • Include appropriate controls such as T3SS-deficient bacteria and non-translocated reporter proteins

This methodology allows for direct visualization and quantification of protein translocation events in real-time, providing insights into the kinetics and efficiency of the T3SS machinery .

How do point mutations in the cytoplasmic domain of YscU affect substrate specificity of the Yersinia T3SS?

Mutations in the cytoplasmic domain of YscU can dramatically alter the substrate selection properties of the T3SS apparatus. Research demonstrates that specific point mutations can suppress phenotypes associated with yscP mutations by restoring Yop effector secretion to levels higher than those observed in wild-type strains, while simultaneously reducing YscF needle component secretion .

For investigating these effects, researchers should employ site-directed mutagenesis approaches:

  • Use template plasmids containing wild-type yscU (e.g., pPE33) under control of inducible promoters

  • Design mutagenic primers targeting specific residues in the cytoplasmic domain

  • Perform site-directed mutagenesis using commercial kits (e.g., GeneEditor in vitro site-directed mutagenesis kit)

  • Verify mutations by sequencing

  • Transform mutant constructs into appropriate Yersinia strains

  • Assess secretion profiles through protein fractionation and immunoblotting

  • Quantify the relative amounts of different substrates (needle components versus effectors)

YscU VariantYscF SecretionYop Effector SecretionPhenotype
Wild-typeNormalNormalFunctional T3SS
yscU cytoplasmic domain mutationsReducedEnhancedSuppression of yscP mutant phenotype
yscP mutant backgroundEnhancedReducedDefective effector secretion

What is the relationship between mRNA properties and protein targeting in the type III secretion signal of Yop proteins?

The relationship between mRNA properties and protein targeting in T3SS is complex and not fully understood. Research on YopN has revealed that synonymous mutations (wobble mutations) that alter the mRNA sequence without changing the amino acid sequence can abolish secretion of hybrid proteins, suggesting that at least part of the secretion signal may be encoded at the mRNA level rather than solely in the protein sequence .

To investigate this phenomenon, researchers should:

  • Design synonymous mutations in the secretion signal region that preserve amino acid sequence

  • Create gene fusions with reporter proteins (e.g., Npt or β-lactamase)

  • Analyze secretion efficiency of wild-type versus mutant constructs

  • Perform nucleotide-level mutational analysis to identify critical positions in the mRNA sequence

  • Use transversion mutations (replacing purines with pyrimidines or vice versa) to test the importance of specific nucleotide positions

  • Assess the effects of mutations on both mRNA structure and protein secretion

Research has demonstrated that several nucleotide positions (e.g., A4U, U11A, A14U, U20A, A21U, U25A, and C30G) in the 36-nucleotide sequence of yopN are particularly sensitive to mutation and may play crucial roles in secretion signaling .

How can researchers distinguish between pre-translational and post-translational secretion mechanisms in the T3SS?

Distinguishing between pre-translational and post-translational secretion mechanisms is challenging but crucial for understanding T3SS function. Evidence from YopN studies suggests that proteins can travel through the T3SS pathway post-translationally, as indicated by N-terminal modifications by Def and MAP (methionine aminopeptidase) prior to secretion .

To investigate these mechanisms, researchers should implement:

  • Pulse-chase experiments with radioactively labeled amino acids to track protein synthesis and secretion temporally

  • N-terminal protein sequencing (Edman degradation) to identify post-translational modifications

  • Inhibitor studies using translation inhibitors (e.g., chloramphenicol) added at different time points

  • Separation of bacterial cultures into cellular and secreted fractions at various time points after induction

  • Construction of translation-arrested systems where mRNAs are targeted to the secretion apparatus before translation is completed

For example, studies of YopN using N-terminal sequencing revealed that the first eluted residue was threonine rather than methionine, indicating post-translational modification by Def and MAP enzymes before secretion through the T3SS .

What are the optimal approaches for generating and analyzing yscU and yscP mutants in Yersinia species?

Generating and analyzing yscU and yscP mutants requires careful genetic manipulation techniques. Based on established protocols in the field, researchers should:

For yscP mutants:

  • Design PCR primers to amplify fragments complementary to upstream and downstream regions of the yscP gene

  • Use PCR to generate deletion constructs that preserve reading frames

  • Clone these constructs into suicide vectors (e.g., pDM4)

  • Transform constructs into appropriate E. coli strains (e.g., S17-1λpir)

  • Introduce mutations into Yersinia through conjugation

  • Select for single recombination events using appropriate antibiotics

  • Counter-select to identify clones that have lost the plasmid through a second recombination event

  • Verify deletions by PCR and sequencing

For yscU mutations:

  • Amplify the yscU gene from genomic DNA using high-fidelity DNA polymerase

  • Clone the gene into expression vectors under inducible promoters

  • Perform site-directed mutagenesis targeting the cytoplasmic domain

  • Transform mutant constructs into appropriate Yersinia strains

  • Induce expression using IPTG or other inducers

  • Analyze secretion phenotypes through protein fractionation and immunoblotting

The resulting mutants should be characterized for:

  • Growth properties at different temperatures

  • Needle complex formation using electron microscopy

  • Protein secretion profiles under secretion-inducing conditions

  • Yop translocation efficiency into host cells

  • Virulence in appropriate infection models

What statistical approaches are most appropriate for analyzing translocation efficiency data in T3SS research?

When analyzing translocation efficiency data in T3SS research, researchers should employ robust statistical methods that account for the complex, often skewed nature of biological data. Contrary to simplistic graphical representations that might obscure important details, detailed statistical tables with appropriate significance indicators provide more reliable interpretation .

For translocation efficiency studies, recommended approaches include:

  • Analysis of variance (ANOVA) with post-hoc tests for comparing multiple experimental conditions

  • Mixed-effects models for experiments with repeated measures or nested designs

  • Robust regression methods when data violate assumptions of normality

  • Quantile regression for exploring effects across different portions of the response distribution

Data should be presented in tables with sufficient precision to allow readers to evaluate the magnitude of effects, accompanied by appropriate statistical metrics:

ConstructMean Translocation Efficiency (%)Standard Errornp-value
Wild-type YopH-Bla68.34.212Reference
YopH₁₋₉₉-Bla64.74.5120.568
YopH₁₋₅₀-Bla42.83.912<0.001*
YopH₁₋₂₀-Bla18.52.812<0.001*
Control (No T3SS)2.30.612<0.001*

*Statistically significant compared to wild-type (p<0.05)

Researchers should avoid excessive decimal places while ensuring sufficient precision to distinguish biologically meaningful differences. Multiple comparisons should be properly addressed using methods such as Bonferroni correction or false discovery rate control .

How can researchers effectively design fusion constructs to study secretion signals in Yop proteins?

Designing effective fusion constructs for studying Yop protein secretion signals requires careful consideration of multiple factors. Based on established methodologies, researchers should:

  • Select appropriate reporter proteins:

    • Choose reporters that lack intrinsic secretion signals (e.g., Npt, β-lactamase lacking signal sequence)

    • Ensure reporters are stable and can be readily detected (via antibodies or enzymatic activity)

    • Consider size constraints that might affect secretion efficiency

  • Design fusion junctions carefully:

    • Include the complete secretion signal (minimum 12 codons for YopN)

    • Preserve reading frames to ensure proper translation

    • Consider including flexible linker sequences to minimize structural interference

  • Include proper regulatory elements:

    • Incorporate native promoters and untranslated regions

    • Consider including inducible elements for controlled expression

  • Construct a systematic series of truncations:

    • Create nested deletions to map minimal required sequences

    • Generate both N-terminal and C-terminal truncations

    • Include single-codon resolution near predicted boundaries

  • Design mutagenesis strategies:

    • Include synonymous mutations to distinguish mRNA from protein signals

    • Create systematic point mutations across the signal region

    • Consider frameshift mutations that alter reading frame while preserving nucleotide sequence

Experimental validation should include quantification of both intracellular and secreted fusion proteins, with results expressed as secretion efficiency (percentage of total protein secreted):

Fusion ConstructSecretion Efficiency (%)Standard DeviationSignificance
YopN₁₋₁₅-Npt82.05.3Reference
YopN₁₋₁₄-Npt68.04.8p<0.05*
YopN₁₋₁₃-Npt43.03.7p<0.01*
YopN₁₋₁₂-Npt38.03.5p<0.01*
YopN₁₋₁₁-Npt18.02.6p<0.001*
YopN₁₋₁₀-Npt0.00.0p<0.001*

*Statistical significance relative to YopN₁₋₁₅-Npt construct

What are the current limitations in understanding the molecular mechanism of YscU-mediated substrate switching?

Despite significant advances, several limitations persist in our understanding of YscU-mediated substrate switching in the T3SS:

  • Structural dynamics: The precise conformational changes in YscU that facilitate substrate switching remain poorly characterized. While we know the cytoplasmic domain undergoes autocleavage, how this structurally translates to altered substrate recognition is not fully resolved.

  • Interaction partners: The complete interaction network between YscU, YscP, and other T3SS components during substrate switching needs further clarification. Current models suggest interactions between these proteins regulate the secretion hierarchy, but the molecular details of these interactions remain elusive.

  • Temporal control mechanisms: How the system transitions precisely from needle component secretion to effector secretion upon host cell contact is incompletely understood. The signals that trigger this transition and how they converge on YscU function require further investigation.

  • Substrate recognition: The exact features of different substrates (needle components versus effectors) that are differentially recognized during the switching process have not been completely defined.

To address these limitations, researchers should consider:

  • Cryo-electron microscopy studies of the T3SS apparatus in different functional states

  • Cross-linking and mass spectrometry approaches to capture transient protein-protein interactions

  • Single-molecule techniques to observe dynamic conformational changes in real-time

  • Systems biology approaches to model the integrated network of interactions during substrate switching

How might research on Yop secretion signals inform the development of novel anti-virulence strategies?

Research on Yop secretion signals has significant implications for developing anti-virulence strategies against Yersinia and potentially other pathogens utilizing T3SS. Understanding the molecular mechanisms of secretion signal recognition could lead to several therapeutic approaches:

  • Signal sequence mimetics: Developing peptide or small molecule mimetics of Yop secretion signals could competitively inhibit the secretion apparatus, preventing delivery of virulence factors to host cells.

  • mRNA-targeted strategies: Given the importance of mRNA properties in secretion signaling, antisense oligonucleotides or RNA-targeting small molecules could disrupt the recognition of secretion signals at the mRNA level.

  • YscU/YscP inhibitors: Compounds targeting the interaction between YscU and YscP or affecting the autocleavage of YscU could disrupt the substrate switching mechanism, rendering the T3SS non-functional.

  • Host-targeted approaches: Strategies to protect host cell targets of Yop effectors could complement pathogen-directed approaches.

Future research directions should include:

  • High-throughput screening of compound libraries against reconstituted T3SS components

  • In silico modeling and rational design of inhibitors targeting critical protein-protein interactions

  • Development of cell-based assays to evaluate T3SS inhibition in physiologically relevant contexts

  • Testing combination approaches targeting multiple aspects of T3SS function

What emerging technologies might advance our understanding of the structural dynamics of YscU during T3SS function?

Several emerging technologies hold promise for advancing our understanding of YscU structural dynamics during T3SS function:

  • Cryo-electron tomography: This technique allows visualization of macromolecular complexes in their native cellular context, potentially enabling observation of YscU conformational states during different phases of T3SS activation.

  • Single-molecule FRET (Förster Resonance Energy Transfer): By labeling specific residues in YscU with fluorescent probes, researchers could monitor conformational changes in real-time during substrate switching.

  • Time-resolved X-ray crystallography: This approach could capture transient structural states of YscU during its functional cycle, providing insights into the dynamics of autocleavage and subsequent conformational changes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method can reveal regions of proteins that undergo conformational changes by measuring the rate of hydrogen-deuterium exchange, potentially identifying dynamic regions of YscU during substrate switching.

  • AlphaFold and other AI-based structure prediction tools: These computational approaches could generate structural models of YscU in complex with other T3SS components, guiding experimental design and hypothesis generation.

  • Integrative structural biology approaches: Combining multiple structural techniques (X-ray crystallography, NMR, cryo-EM, molecular dynamics simulations) can provide complementary information about YscU structural dynamics.

Implementation of these technologies should focus on capturing YscU:

  • Before and after autocleavage

  • In complex with YscP and other T3SS components

  • During the transition from needle component secretion to effector secretion

  • In native membrane environments to account for lipid interactions

How should researchers interpret conflicting data regarding the nature of type III secretion signals?

Interpreting conflicting data regarding type III secretion signals requires careful consideration of multiple factors that may contribute to experimental variability. Researchers should:

  • Consider methodological differences:

    • Different reporter systems may have varying sensitivity and specificity

    • Expression levels of fusion constructs can affect secretion efficiency

    • Growth conditions and induction methods may influence results

  • Evaluate model-specific variations:

    • Different Yersinia species or strains may exhibit subtle variations in T3SS function

    • Laboratory-adapted strains may differ from clinical isolates

  • Reconcile competing hypotheses:
    The two main hypotheses regarding secretion signals are:

    • Protein signal hypothesis: Specific amino acid sequences/properties direct secretion

    • mRNA signal hypothesis: Properties of the mRNA direct targeting to the secretion apparatus

    Evidence supports aspects of both models, suggesting a hybrid mechanism may be operative .

  • Statistical approaches for conflicting data:

    • Meta-analysis of multiple studies when available

    • Robust statistical methods that are less sensitive to outliers

    • Consideration of both statistical and biological significance

    • Tabular presentation of conflicting results with methodological details:

StudySystemSignal TypeKey FindingMethodologyLimitations
Study 1YopNProteinFirst 15 aa sufficientGene fusionLimited to one reporter
Study 2YopEmRNAFrameshift mutations functionalFrameshift constructsIndirect measurement
Study 3YopNHybridSynonymous mutations disruptiveWobble mutationsLimited mutation types

Researchers should avoid over-interpreting limited datasets and acknowledge the complexity of the secretion targeting system, which likely involves elements of both mRNA and protein-based recognition .

What quantitative approaches can distinguish between different models of type III secretion regulation?

Distinguishing between different models of T3SS regulation requires rigorous quantitative approaches that can test specific predictions of each model. Researchers should employ:

  • Kinetic analyses:

    • Measure secretion rates under various conditions

    • Determine temporal ordering of substrate secretion

    • Use pulse-chase experiments to track substrate fates

  • Dose-response relationships:

    • Vary expression levels of regulatory proteins (YscP, YscU)

    • Quantify effects on different substrate classes

    • Establish threshold concentrations for switching

  • Thermodynamic measurements:

    • Determine binding affinities between regulatory components

    • Measure energy requirements for different secretion events

    • Assess conformational stability of key components

  • Formal mathematical modeling:

    • Develop competing mathematical models based on different regulatory hypotheses

    • Parameterize models using experimental data

    • Compare model predictions to experimental outcomes using rigorous statistical criteria

An example quantitative framework for comparing models:

Model ParameterCompetitive Binding ModelSequential Activation ModelAllosteric Regulation ModelExperimental Value
YscF:YopE secretion ratio (wild-type)0.2:10.25:10.3:10.28:1 ± 0.05
YscF:YopE ratio (yscP mutant)5:12:1>10:16.3:1 ± 1.2
Response time to host contact<30s60-120s30-60s45s ± 12s
ATP requirement (relative units)HighLowModerateModerate
YscU cleavage effectComplete switchPartial effectGraduated responseGraduated response

Based on this type of quantitative comparison, researchers can determine which model best fits the experimental data and design critical experiments to further distinguish between remaining candidate models .

What are promising approaches for studying the real-time dynamics of the T3SS substrate switching mechanism?

Studying the real-time dynamics of T3SS substrate switching requires innovative approaches that capture the temporal and spatial aspects of this complex process. Promising methodological directions include:

  • Live-cell imaging techniques:

    • Fluorescent protein tagging of key T3SS components

    • Super-resolution microscopy to visualize assembly and substrate switching

    • FRET-based sensors to detect protein-protein interactions in real-time

  • Microfluidic systems:

    • Rapid media exchange to control T3SS activation

    • Single-cell analysis of secretion events

    • Co-culture systems with host cells to trigger natural substrate switching

  • Optogenetic control:

    • Light-inducible protein interactions to trigger conformational changes in YscU

    • Spatiotemporal control of T3SS component activation

    • Dissection of signaling cascades leading to substrate switching

  • In vitro reconstitution:

    • Purified component assembly in artificial membranes

    • Controlled addition of substrates and regulatory factors

    • Direct observation of transport events

  • High-speed atomic force microscopy:

    • Visualization of conformational changes in membrane-embedded complexes

    • Tracking of structural dynamics during substrate engagement and translocation

These approaches should be applied to address specific questions about switching dynamics:

  • What is the precise temporal sequence of events during switching?

  • How rapidly does the system respond to host cell contact?

  • Is substrate switching an all-or-none or a graduated process?

  • How is substrate selection coordinated across multiple T3SS apparatuses on a single bacterium?

How might cross-species comparative studies of YscU homologs inform our understanding of T3SS evolution and function?

Cross-species comparative studies of YscU homologs can provide valuable insights into T3SS evolution and function through several approaches:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenies of YscU homologs across bacterial species

    • Map functional adaptations onto evolutionary trees

    • Identify conserved versus variable regions that correlate with host range or virulence

  • Structure-function comparisons:

    • Compare crystal structures of YscU homologs from different pathogens

    • Identify conserved structural features critical for function

    • Characterize species-specific adaptations

  • Functional complementation studies:

    • Express YscU homologs from different species in Yersinia yscU mutants

    • Assess restoration of secretion function and substrate specificity

    • Identify critical domains through chimeric protein construction

  • Co-evolution analysis:

    • Investigate co-evolutionary relationships between YscU and its interaction partners

    • Identify compensatory mutations that maintain function across species

    • Reconstruct ancestral protein sequences to trace evolutionary trajectories

The resulting data could be organized in comparative tables:

SpeciesYscU HomologAutocleavage SiteSubstrate SpecificityHost RangeUnique Features
Y. enterocoliticaYscUNPTHYopB/D/E/H/M/N/P/Q/TMammalsReference protein
P. aeruginosaPscUNPTHExoS/T/U/YMammals, insectsExtended C-terminal domain
S. typhimuriumSpaSNPTHSipB/C/D, SptP, AvrAMammals, birdsAlternative binding site
E. coli (EPEC)EscUNPTHTir, Map, EspF/G/HMammalsAltered pH sensitivity
X. campestrisHrcUNPTHAvrBs1/2/3, XopD/E/NPlantsPlant-specific adaptations

This comparative approach would illuminate how YscU function has been conserved or adapted across different bacterial pathogens with diverse host ranges and infection strategies .

What are the critical research gaps in understanding the coordination between YscP, YscU, and other T3SS components?

Despite significant progress, several critical research gaps remain in understanding the coordination between YscP, YscU, and other T3SS components:

  • Structural basis of interactions:

    • High-resolution structures of YscP-YscU complexes are lacking

    • Conformational changes during substrate switching are poorly defined

    • Interaction interfaces with other T3SS components remain uncharacterized

  • Signal transduction mechanisms:

    • How host cell contact signals are transmitted to YscP/YscU is unclear

    • Molecular events linking needle length control to substrate switching need clarification

    • Role of post-translational modifications in regulating these interactions requires investigation

  • Temporal coordination:

    • Precise timing of YscP-YscU interactions during T3SS assembly and activation

    • Mechanisms ensuring proper sequential assembly of T3SS components

    • Feedback loops regulating the transition between different secretion modes

  • Integration with other regulatory systems:

    • Cross-talk between T3SS regulation and other bacterial signaling pathways

    • Environmental factors affecting YscP-YscU coordination

    • Host factors potentially influencing substrate switching

To address these gaps, researchers should develop:

  • Advanced protein-protein interaction detection methods applicable in native membrane environments

  • Genetic approaches for temporal control of component expression/activation

  • Systems biology frameworks integrating multiple regulatory inputs

  • Quantitative models of T3SS assembly and activation kinetics

A systematic research roadmap might include:

Research GapCurrent KnowledgeMethodological ApproachExpected Impact
YscP-YscU structural interfaceLimited to domain-level interactionsCryo-EM, cross-linking MS, HDX-MSEssential for structure-based inhibitor design
Signal transduction from needle to baseHypothetical models onlyFRET sensors, conformation-specific antibodiesCritical for understanding activation mechanism
Substrate recognition specificityBasic signals identified but mechanism unclearSystematic mutation analysis, quantitative binding studiesPotential for targeted manipulation of T3SS function
Coordination with transcriptional regulationKnown to be linked but mechanisms undefinedRNA-seq, ChIP-seq, reporter systemsIntegration of T3SS into global virulence networks

Addressing these gaps will require multidisciplinary approaches combining structural biology, genetics, biochemistry, and systems biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.