Recombinant Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1 (MT-ND1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Zaglossus bruijni MT-ND1 is a mitochondrial protein subunit of NADH-ubiquinone oxidoreductase (Complex I), produced via in vitro expression systems. Derived from the mitochondrial genome of the Western long-beaked echidna (Zaglossus bruijni), this recombinant protein facilitates studies on electron transport chain dynamics, ubiquinone binding, and proton channel regulation . Its production in heterologous systems like E. coli allows scalable yields for biochemical and therapeutic research .

Production and Purification

This recombinant protein is synthesized using E. coli expression systems, followed by affinity chromatography leveraging the His-tag . Production parameters include:

ParameterDetail
Expression HostEscherichia coli (prokaryotic system)
VectorPlasmid-based, optimized for high-yield cytoplasmic expression
Purification MethodImmobilized metal affinity chromatography (IMAC)
Purity>90% (SDS-PAGE verified)

Biochemical Properties

Recombinant Zaglossus bruijni MT-ND1 retains the functional attributes of native Complex I subunits:

  • Electron Transfer: Mediates electron flow from NADH to ubiquinone via flavin mononucleotide (FMN) and iron-sulfur clusters .

  • Proton Pumping: Facilitates proton translocation across the mitochondrial inner membrane, critical for ATP synthesis .

  • Ubiquinone Binding: Forms part of the CoQ-binding pocket, mutations in which disrupt energy production .

Mitochondrial Disease Modeling

MT-ND1 mutations are linked to Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome . Recombinant proteins enable in vitro studies of pathogenic variants like G3460A, which impair ubiquinone binding and proton coupling .

Cancer Research

MT-ND1 dysregulation is observed in tumors, where it may serve as a biomarker for metabolic shifts toward glycolysis . Recombinant variants help elucidate its role in cancer progression and therapy resistance .

Evolutionary Studies

Comparative analyses with homologs from humans, mice, and birds (e.g., Anas platyrhynchos) reveal conserved functional domains across species .

Key Research Findings

  1. Structural Insights: Cryo-EM studies show MT-ND1’s role in stabilizing Complex I’s transmembrane domain, with mutations disrupting subunit interactions .

  2. Pathogenic Mutations: The G3460A mutation reduces NADH dehydrogenase activity by 60%, correlating with LHON severity .

  3. Therapeutic Targets: Small molecules targeting MT-ND1’s ubiquinone-binding site show potential for treating mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of that specified tag.
Synonyms
MT-ND1; MTND1; NADH1; ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Zaglossus bruijni (Western long-beaked echidna)
Target Names
Target Protein Sequence
ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFI LAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGA LRAVAQTISYEVTLAIILLSIMLINGSFTLTTLNLTQEFMWLVVPTWPLMLTRFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLP ELSTINFMIKTMMLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFIMLPLALS WIP
Uniprot No.

Target Background

Function
Recombinant Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is crucial for the catalytic activity and assembly of complex I.
Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND1 and what is its basic function in mitochondria?

MT-ND1 is a mitochondrially encoded protein that serves as a core subunit of NADH dehydrogenase (complex I), the first and largest enzyme complex in the mitochondrial electron transport chain. This 36 kDa protein plays several critical roles:

  • Contributes to NADH dehydrogenase activity, facilitating electron transfer from NADH to coenzyme Q10

  • Participates in proton translocation across the inner mitochondrial membrane

  • Helps build the electrochemical potential difference used for ATP production

  • Forms part of the ubiquinone binding site structure

The reaction catalyzed by complex I, which MT-ND1 contributes to, can be represented as:

NADH + H+ + CoQ + 4H+in → NAD+ + CoQH2 + 4H+out

This process transfers electrons while simultaneously pumping protons across the membrane, which is essential for cellular energy production. Disruptions to MT-ND1 function can have severe consequences for cellular metabolism and viability.

What is the structure and genomic location of MT-ND1?

The MT-ND1 gene is located in the mitochondrial genome with the following characteristics:

  • In humans, it spans from nucleotide position 3,307 to 4,262 in the mitochondrial DNA

  • It is encoded by the guanine-rich heavy chain (H) of mtDNA

  • It produces a protein composed of 318 amino acids

The MT-ND1 protein is strategically positioned at the junction of the hydrophilic and hydrophobic domains of complex I, where it contributes to:

  • The ubiquinone binding pocket

  • The proton pump structure

  • The coupling mechanism between electron transfer and proton translocation

This position makes MT-ND1 critical for both the structural integrity and functional activity of complex I, explaining why mutations in this gene often have significant pathological consequences.

How does MT-ND1 contribute to respiratory complex I assembly?

MT-ND1 plays a crucial role in the early stages of complex I assembly. The process involves:

  • Incorporation of MT-ND1 into the membrane arm during initial assembly

  • Interaction with nuclear-encoded subunits to form subcomplexes

  • Formation of an essential interface between the membrane and peripheral arms of complex I

When MT-ND1 is absent or mutated above a critical threshold (typically 85-93% heteroplasmy for some mutations), the assembly process is disrupted, leading to:

  • Accumulation of assembly intermediates

  • Degradation of other complex I subunits

  • Reduced levels of fully assembled complex I

  • Impaired formation of respiratory supercomplexes (CI+CIII2+CIV and CI+CIII2)

Interestingly, even small amounts of wild-type MT-ND1 expression can partially rescue complex I assembly, highlighting the protein's essential role in this process. This explains why cells often upregulate assembly factors in response to MT-ND1 mutations as a compensatory mechanism.

What experimental applications is recombinant Zaglossus bruijni MT-ND1 used for?

Recombinant Zaglossus bruijni MT-ND1 protein has several important applications in mitochondrial research:

  • As a standard in enzyme-linked immunosorbent assays (ELISA) for quantifying MT-ND1 levels

  • For generating antibodies against MT-ND1 for immunological studies

  • As a control protein in complex I assembly and activity assays

  • For structural studies of MT-ND1 and its interactions with other subunits

  • In evolutionary studies comparing mitochondrial proteins across species

The commercially available recombinant protein is typically supplied at 50 μg quantity in a Tris-based buffer with 50% glycerol. For optimal results, it should be stored at -20°C for regular use or -80°C for extended storage, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What methodologies are most effective for studying MT-ND1 mutations?

Investigating MT-ND1 mutations requires a multifaceted approach combining genetic, biochemical, and functional analyses:

Methodology CategoryTechniquesApplications
Genetic Analysis- Next-generation sequencing
- Droplet digital PCR
- Single-cell sequencing
- Comprehensive mtDNA analysis
- Precise heteroplasmy quantification
- Cell-specific mutation distribution
Biochemical Assessment- Complex I enzyme activity assays
- Blue native PAGE
- Western blotting
- Functional impact evaluation
- Complex I assembly status
- Protein level quantification
Functional Studies- High-resolution respirometry
- Membrane potential measurements
- ROS production assays
- Oxygen consumption analysis
- Bioenergetic assessment
- Oxidative stress evaluation

When studying novel mutations, researchers should consider the mutation's location within the protein structure. For example, mutations that disrupt the electrostatic force between MT-ND1 and nuclear subunits like NDUFA1 typically affect complex assembly, while those in functional domains may primarily impact catalytic activity .

Recent studies have shown that mutations such as m.3955G>A interfere with MT-ND1 expression, while others like m.3946G>A (p.E214K) decrease protein stability—highlighting the importance of characterizing the specific molecular consequences of each mutation .

How can researchers distinguish between pathogenic and non-pathogenic variants in MT-ND1?

Determining the pathogenicity of MT-ND1 variants requires integrating multiple lines of evidence:

  • Population Genetics Analysis:

    • Frequency in population databases

    • Conservation across species

    • Haplogroup association analysis

  • In Silico Prediction:

    • Structure-based analysis of critical domains

    • Molecular dynamics simulations

    • Machine learning algorithms trained on known pathogenic variants

  • Functional Validation:

    • Complex I activity measurements

    • Assessment of MT-ND1 protein levels

    • Evaluation of complex I assembly status

    • Measurement of mitochondrial respiration rates

  • Threshold Analysis:

    • Determination of the heteroplasmy level required for biochemical defects

    • Correlation between heteroplasmy and phenotype severity

Several pathogenic MT-ND1 variants have been associated with specific diseases, including:

PositionMutationAmino Acid ChangeAssociated Disease
MT-ND13959 G>AGly to AspMELAS
MT-ND13995 A>GAsn to SerMELAS
MT-ND14171 C>ALeu to MetLHON
MT-ND14216 T>CVal to LeuT2D, Cancer

These pathogenic mutations typically disturb protein structure, affect complex I function, disrupt mitochondrial electron transport, and impair cellular energy metabolism.

What are the challenges in expressing and purifying recombinant MT-ND1?

Working with recombinant MT-ND1 presents several technical challenges:

  • Hydrophobicity and Membrane Integration:

    • MT-ND1 contains multiple transmembrane domains

    • Requires specialized expression systems and detergents

  • Genetic Code Differences:

    • Mitochondrial genetic code differs from the universal code

    • Codon optimization is necessary for expression in conventional systems

  • Protein Stability:

    • Isolated MT-ND1 may be unstable without associated subunits

    • Storage typically requires 50% glycerol and -20°C conditions

  • Functional Assessment:

    • Difficult to verify native functionality of the isolated subunit

    • May require reconstitution experiments with other complex I components

Successful strategies for recombinant MT-ND1 production include:

  • Use of specialized expression hosts

  • Addition of solubility-enhancing tags

  • Optimization of buffer conditions

  • Cell-free expression systems for toxic proteins

  • Co-expression with interacting partners

How do MT-ND1 mutations affect respiratory chain supercomplex formation?

MT-ND1 mutations significantly impact the formation and stability of mitochondrial respiratory chain supercomplexes:

  • Disruption of Initial Complex I Assembly:

    • MT-ND1 mutations prevent proper complex I formation

    • This leads to accumulation of assembly intermediates

  • Impaired Supercomplex Formation:

    • Properly assembled complex I is required for respirasomes

    • MT-ND1 mutations disrupt CI+CIII2+CIV and CI+CIII2 supercomplexes

  • Threshold Effects:

    • High heteroplasmy levels (85-93% for some mutations) result in complete loss of MT-ND1

    • Even small amounts of wild-type MT-ND1 can partially restore supercomplex assembly

  • Compensatory Mechanisms:

    • Upregulation of assembly factors in response to mutations

    • Enhanced stabilization of existing supercomplexes

Research has shown that the m.3571insC mutation does not affect MT-ND1 transcription but impairs its translation and/or promotes rapid degradation. This leads to decreased complex I and IV activities and disrupted supercomplex formation, highlighting the far-reaching consequences of MT-ND1 deficiency beyond just complex I .

What is the role of MT-ND1 in coupling electron transfer to proton pumping?

MT-ND1 plays a crucial role in the long-range coupling mechanism between electron transfer and proton pumping in complex I:

  • Ubiquinone Binding Site Contribution:

    • MT-ND1 forms part of the ubiquinone binding pocket

    • Electron transfer to ubiquinone initiates conformational changes

  • Structural Linkage:

    • MT-ND1 is positioned at the junction of the peripheral (electron transfer) and membrane (proton pumping) domains

    • It participates in transmitting conformational changes between these domains

  • Proton Pathway Formation:

    • Contains residues that may form part of proton translocation channels

    • Mutations affecting these residues can disrupt proton pumping while preserving electron transfer

This coupling mechanism remains an active area of research, with no complete consensus on the exact mechanism. The contribution of MT-ND1 to both ubiquinone reduction and proton pumping makes it a key component for understanding the function of complex I in the mitochondrial respiratory chain .

Studying this coupling requires sophisticated techniques including:

  • Site-directed mutagenesis of key residues

  • High-resolution structural analysis

  • Spectroscopic methods to track electron transfer

  • Proton translocation assays

What disorders are associated with MT-ND1 mutations?

MT-ND1 mutations have been linked to several mitochondrial disorders:

  • Leber Hereditary Optic Neuropathy (LHON):

    • Characterized by sudden-onset central vision loss

    • Several MT-ND1 mutations (e.g., m.4171C>A) are associated with LHON

  • Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like Episodes (MELAS):

    • Presents with stroke-like episodes, seizures, and lactic acidosis

    • MT-ND1 mutations like m.3959G>A and m.3995A>G can cause MELAS

  • Adult-Onset Dystonia:

    • Involves involuntary muscle contractions and abnormal movements

    • The A3796G mutation has been reported in cases of adult-onset dystonia

  • Other Associations:

    • Type 2 diabetes

    • Increased susceptibility to certain cancers

    • Contributions to neurodegenerative conditions like Parkinson's disease

The pathogenic mechanisms vary but generally involve:

  • Reduced complex I activity

  • Increased reactive oxygen species production

  • Impaired ATP synthesis

  • Disturbed calcium homeostasis

  • Altered mitochondrial dynamics

What experimental models are most suitable for studying MT-ND1-related diseases?

Various experimental models offer complementary advantages for investigating MT-ND1-related disorders:

Model TypeExamplesAdvantagesLimitations
Cellular Models- Cybrid cells
- Patient fibroblasts
- iPSC derivatives
- Maintain mtDNA mutations
- Allow controlled genetic background
- Enable tissue-specific studies
- May not recapitulate tissue complexity
- Limited physiological context
Organoid Models- Brain organoids
- Retinal organoids
- Better mimic tissue architecture
- Capture cell-cell interactions
- Lack systemic factors
- Variable reproducibility
Animal Models- Mouse models
- Zebrafish
- Drosophila
- In vivo physiology
- Behavioral assessments
- Drug testing
- Species differences in mtDNA
- Challenging to introduce specific mtDNA mutations
In Vitro Systems- Reconstituted complex I
- Membrane extracts
- Biochemical precision
- Mechanistic insights
- Simplified system
- Limited physiological relevance

When selecting a model, researchers should consider:

  • The specific research question (mechanism, pathophysiology, or therapeutic testing)

  • The nature of the mutation being studied

  • The tissue specificity of the disease manifestations

  • The resources and expertise available

Recent advances in mitochondrial genome editing technologies are expanding the range of available models, potentially enabling more precise recapitulation of human MT-ND1 mutations in various experimental systems.

How can MT-ND1 research contribute to developing therapies for mitochondrial diseases?

Research on MT-ND1 opens several therapeutic avenues for mitochondrial disorders:

  • Gene Therapy Approaches:

    • Mitochondrially-targeted nucleases to shift heteroplasmy

    • Allotopic expression of recoded MT-ND1 from the nucleus

    • RNA-based therapeutics to inhibit mutant mtDNA replication

  • Bypass Strategies:

    • Alternative NADH oxidation pathways

    • Enhancement of alternative energy production routes

    • Metabolic rewiring to reduce dependence on complex I

  • Enhancement of Mitochondrial Function:

    • Upregulation of mitochondrial biogenesis

    • Stimulation of complex I assembly and stability

    • Promotion of supercomplex formation

  • Reduction of Downstream Consequences:

    • Antioxidants targeting mitochondrial ROS

    • Metabolic modifiers to enhance ATP production

    • Agents to improve mitochondrial membrane potential

Understanding the specific molecular consequences of different MT-ND1 mutations is crucial for developing targeted therapies. For example, mutations primarily affecting protein stability might benefit from approaches that enhance MT-ND1 synthesis or reduce its degradation, while those affecting catalytic function might require bypass strategies.

What techniques can quantify the bioenergetic impact of MT-ND1 mutations?

Comprehensive assessment of MT-ND1 mutations' bioenergetic consequences requires multiple complementary approaches:

  • Respiratory Chain Function:

    • High-resolution respirometry for oxygen consumption rates

    • Complex I-specific activity assays using artificial electron acceptors

    • NAD+/NADH ratio measurements in intact cells

  • ATP Production:

    • Luciferase-based ATP quantification assays

    • Real-time ATP monitoring using fluorescent sensors

    • ATP synthesis rates in isolated mitochondria

  • Membrane Potential:

    • Fluorescent dyes (TMRM, JC-1) for mitochondrial membrane potential

    • Time-resolved measurements to detect subtle defects

  • Metabolic Profiling:

    • Lactate/pyruvate ratios as indicators of NADH/NAD+ balance

    • Targeted metabolomics focusing on TCA cycle intermediates

    • Isotope tracing to track metabolic flux alterations

  • Oxidative Stress Parameters:

    • Mitochondrial ROS production assessment

    • Oxidative damage markers

    • Antioxidant system evaluation

These methods provide a comprehensive picture of how MT-ND1 mutations affect cellular bioenergetics, helping researchers understand the pathogenic mechanisms and potential compensatory pathways that might be therapeutically exploited.

How can researchers investigate interactions between MT-ND1 and other complex I subunits?

Understanding the interactions between MT-ND1 and other complex I components is crucial for elucidating assembly mechanisms and disease pathogenesis:

  • Structural Analysis:

    • Cryo-electron microscopy of intact complex I

    • Computational modeling and docking studies

    • Hydrogen/deuterium exchange mass spectrometry

  • Protein-Protein Interaction Studies:

    • Chemical crosslinking coupled to mass spectrometry

    • Co-immunoprecipitation of native complexes

    • Proximity labeling techniques (BioID, APEX2)

  • Genetic Approaches:

    • Suppressor screening to identify compensatory mutations

    • Correlated mutation analysis across species

    • Assembly factor knockout/knockdown studies

Research has revealed that MT-ND1 forms critical interactions with nuclear-encoded subunits such as NDUFA1, and mutations in MT-ND1 can disrupt these electrostatic interactions, affecting complex I assembly and stability .

This interaction network is particularly important because mutations in MT-ND1 can have far-reaching effects on the assembly and function of the entire complex I structure, explaining the diverse phenotypic consequences of different mutations in this gene.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.