Recombinant Zea mays 15-cis-zeta-carotene isomerase, chloroplastic

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant Z-ISO is produced via heterologous expression in Escherichia coli ( ). Key features include:

PropertyDetail
Host OrganismEscherichia coli ( )
TagN-terminal His tag ( )
Protein Length321 amino acids (mature protein: residues 46–366) ( )
Molecular FunctionHeme B-dependent isomerase ( )
Substrate9,15,9′-tri-cis-ζ-carotene ( )
Product9,9′-di-cis-ζ-carotene ( )
Purity>90% (SDS-PAGE) ( )
StorageLyophilized in Tris/PBS buffer with 6% trehalose ( )

The enzyme’s activity depends on a heme B cofactor, which undergoes redox-regulated conformational changes to facilitate substrate binding ( ). AlphaFold structural models predict a membrane-integrated topology with conserved substrate-binding pockets across plant and cyanobacterial homologs ( ).

Functional Role in Carotenoid Biosynthesis

Z-ISO catalyzes the cis-to-trans isomerization of the central 15–15′ double bond in ζ-carotene, enabling downstream desaturation and cyclization reactions ( ). Key findings:

  • Light-Independent Activity: Essential in dark tissues (e.g., roots, etiolated leaves) where photoisomerization is absent ( ).

  • Redox Sensitivity: Activity correlates with plastid redox state, linking carotenoid synthesis to cellular metabolic signals ( ).

  • Epistatic Interactions: In Arabidopsis, Z-ISO mutants (e.g., ziso-155) disrupt plastid development unless combined with carotenoid cleavage dioxygenase (CCD) inhibitors, implicating apocarotenoid retrograde signals ( ).

Heterologous Complementation Studies

  • Substrate Specificity: Recombinant Z-ISO expressed in E. coli confirmed exclusive activity on 9,15,9′-tri-cis-ζ-carotene, with no cross-reactivity on phytoene ( ).

  • Mutant Rescue: Complementation of Synechocystis Δslr1599 (Z-ISO-deficient) restored carotenoid synthesis under darkness ( ).

Mechanistic Insights

  • Heme Dependency: Spectroscopic studies confirmed heme B’s role in redox-mediated activation ( ).

  • Structural Predictions: AlphaFold models identified conserved histidine residues (His-154, His-158 in maize) as putative heme ligands ( ).

Biotechnological Relevance

  • Biofortification: Z-ISO is a target for enhancing provitamin A in crops like maize and rice ( ).

  • Stress Adaptation: Modulates carotenoid flux under temperature fluctuations, impacting plant resilience ( ).

Comparative Analysis of Z-ISO Homologs

OrganismKey FeatureReference
Zea mays (maize)Heme B-dependent; critical for endosperm carotenoids
Arabidopsis thalianaEpistatic with CCDs; regulates etioplast development
Synechocystis sp. PCC6803Light-independent activity confirmed in cyanobacteria
Euglena gracilisZ-ISO activity conserved in non-photosynthetic eukaryotes

Challenges and Future Directions

  • Structural Resolution: No crystallographic data exists; resolving Z-ISO’s 3D structure remains a priority ( ).

  • Apocarotenoid Signaling: The role of Z-ISO-derived metabolites in plastid-nuclear communication requires further study ( ).

  • Engineering Applications: Optimizing Z-ISO for high-yield carotenoid production in synthetic biology systems ( ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
15-cis-zeta-carotene isomerase, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-366
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Protein Sequence
SHARPARAVGGGIEPKEGVVAEGDESGGGPVLVGEDSAAFELKDQSVASWAYFAGILGAV LVALNVLWIDPSTGVGTKFLDAVASVSDSHEVVMLLLTIIFAVVHSGMASLRESGEKIVG ERVYRVLFAGISLPLAVTTIVYFINHRYDGTQLWQVQGITGIHELLWFSSFISFFFLYPS TFNLLEVAAVDKPKLHMWETGIMRITRHPQMVGQVIWCLAHTLWIGNSVAVAASVGLISH HLFGAWNGDRRLLSRYGEAFEVLKKRTSVMPFAAIIDGRQKLPKDYHKEFFRLPYVAITM LTLGAYFAHPLMQASSYQLPW
Uniprot No.

Target Background

Function
This isomerase plays a crucial role in carotenoid biosynthesis. It catalyzes the cis- to trans-conversion of the 15-cis-bond in 9,15,9'-tri-cis-zeta-carotene.
Gene References Into Functions
  1. As an isomerase, Z-ISO represents a novel prototype for heme b proteins and potentially utilizes a unique chemical mechanism. PMID: 26075523
Database Links
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and roots, and at lower levels in embryos and endosperm.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.