Recombinant Zea mays 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGR)

Recombinant Zea mays 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR) is a full-length, His-tagged enzyme expressed in Escherichia coli. It represents a critical tool for studying isoprenoid biosynthesis, particularly in maize (Zea mays). HMGR catalyzes the NADPH-dependent reduction of HMG-CoA to mevalonate, a rate-limiting step in the mevalonate (MVA) pathway, which produces sterols, triterpenes, and other essential secondary metabolites . This recombinant protein is engineered for biochemical and structural studies, enabling researchers to explore its catalytic mechanisms, regulatory dynamics, and interactions with substrates or inhibitors.

Functional Role in the Mevalonate Pathway

HMGR is pivotal in the MVA pathway, regulating flux toward isoprenoid precursors. In Zea mays, native HMGR activity peaks during seed development (embryo and endosperm) and germination, supporting rapid growth and metabolite synthesis . The recombinant enzyme mimics these functions in vitro, enabling controlled studies of:

  • Enzymatic Kinetics: Substrate specificity (HMG-CoA vs. analogs).

  • Regulatory Mechanisms: Feedback inhibition by sterols or phosphorylation .

  • Metabolic Engineering: Overexpression strategies to enhance isoprenoid yields in bioproduction systems .

Production and Purification

The recombinant HMGR is produced via bacterial expression, leveraging E. coli’s high yield and cost efficiency. Key production parameters include:

ParameterDetail
HostE. coli .
Purity>90% as verified by SDS-PAGE .
StorageLyophilized powder stored at -20°C/-80°C in Tris/PBS buffer with 6% trehalose .
ReconstitutionSuspend in sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .

Purification Challenges:

  • Protein Aggregation: Mitigated by low-temperature storage and trehalose stabilization .

  • Activity Retention: Confirmed via functional assays (e.g., NADPH-dependent HMG-CoA reduction) .

Applications in Research

The recombinant HMGR is utilized in diverse experimental frameworks:

ApplicationDetails
Enzymatic AssaysQuantification of HMG-CoA reduction using UV-Vis (NADPH/NADP+ absorbance) .
Structural StudiesCrystallization trials to resolve domain interactions and substrate binding .
Inhibitor ScreeningTesting statins or bisphosphonates for competitive inhibition .
Pathway EngineeringCo-expression with terpene synthases to optimize sesquiterpene biosynthesis .

Case Study: HMGR overexpression in Lactococcus lactis modestly increased sesquiterpene yields, highlighting downstream bottlenecks in isoprenoid pathways .

Developmental Regulation in Zea mays

Native HMGR activity fluctuates during seed development:

  • Peak Activity: 216.1 units (endosperm) and 140.2 units (embryo) at 10–12 days post-pollination .

  • Maturation Decline: Endosperm activity drops to ~20% of peak levels during desiccation .

  • Germination Recovery: Embryo activity rises to 5.1 units post-imbibition, supporting germination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
HMGR; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
HMGR
Target Protein Sequence
MEVRGGVGQGSAARHPPAPEPSRAAARVQAGDALPLPIRHTNLIFSALFAASLAYLMRRW REKIRSSTPLHAVGLAEMLAIFGLVASLIYLLSFFGIAFVQSIVSSGDDDEDFLVGSGSS GSAAAPSRQHAQAPAPCELLGSPAAAPEKMPEDDEEIVASVVAGKVPSYALEARLGDCRR AAGIRREALRRITGRDIEGLPLDGFDYASILGQCCELPVGYVQLPVGVAGPLLLDGRRFY LPMATTEGCLVASTNRGCKAIAESGGATSVVLRDAMTRAPVARFPTARRAAELKAFLEDP ANFDTLSVVFNRSSRFARLQGVQCAMAGRNLYMRFSCSTGDAMGMNMVSKGVQNVLDFLQ DDFHDMDVISISGNFCSDKKPSAVNWIEGRGKSVVCEAVIGEEVVKKVLKTDVQSLVELN TIKNLAGSAVAGALGGFNAHASNIVTAIFIATGQDPAQNVESSHCITMLEPVNAGRDLHI SVTMPSIEVGTVGGGTQLASQSACLDLLGVRGASRDRPGSNARLLATVVAGGVLAGELSL LSALAAGQLVKSHMKYNRSSKDVSSTTATEKTRQREVDV
Uniprot No.

Target Background

Function

This enzyme catalyzes the synthesis of mevalonate, a precursor to all isoprenoid compounds in plants.

Database Links

STRING: 4577.GRMZM2G393337_P02

UniGene: Zm.35108

Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What experimental strategies ensure successful expression of recombinant Zea mays HMGR in bacterial systems?

Recombinant HMGR expression in Escherichia coli requires codon optimization and careful vector design. The full-length HMGR gene (1-579 aa) is typically cloned into plasmids with strong promoters (e.g., T7 or nisin-inducible systems) and fused to N-terminal His-tags for purification . For example, the construct pNZ:PMSTS:mvaA uses dual cloning of HMGR (mvaA) alongside a sesquiterpene synthase gene under a single promoter, with ribosomal binding sites (RBS) ensuring coordinated translation . Critical parameters include:

  • Induction conditions: Optimal protein yield occurs at 40 ng/mL nisin for 2 hours post-induction at OD600 = 0.4 .

  • Temperature: Lower temperatures (25°C) reduce inclusion body formation.

  • Vector selection: pET or pNZ8048 systems are preferred for high-yield cytoplasmic expression .

How is recombinant HMGR purified, and what purity thresholds are acceptable for functional studies?

Affinity chromatography using Ni-NTA resins is standard due to the His-tag fusion. Post-sonication, crude lysates are loaded onto His SpinTrap columns pre-equilibrated with 20 mM imidazole, followed by elution at 300 mM imidazole . SDS-PAGE analysis confirms >90% purity, essential for kinetic assays . Desalting via HiTrap columns removes imidazole, which can inhibit enzymatic activity. A representative purification workflow yields ~0.5 mg protein per liter of culture .

What functional assays validate HMGR activity in vitro?

The NADPH-dependent reduction of HMG-CoA to mevalonate is measured spectrophotometrically at 340 nm (extinction coefficient = 6,220 M⁻¹cm⁻¹) . A typical 1 mL reaction contains:

  • 25 mM KH₂PO₄ (pH 7.5)

  • 0.25 mM NADPH

  • 0.25 mM HMG-CoA

  • 5 mM DTT

Activity is linear for 3 minutes, with negative controls omitting HMG-CoA or using heat-denatured enzyme . Specific activity ≥ 50 nmol/min/mg indicates functional integrity .

How do conserved domains in Zea mays HMGR influence catalytic efficiency and substrate binding?

Zea mays HMGR shares four conserved domains with fungal and plant homologs:

  • N-terminal transmembrane anchor: Mediates endoplasmic reticulum localization.

  • Linker region: Flexible hinge enabling conformational shifts.

  • Catalytic domain: Binds HMG-CoA via residues Ser684, Asp767, and Lys271 (numbering based on Ganoderma lucidum HMGR) .

  • NADPH-binding motif: GXGXXG sequence (positions 890–895) critical for cofactor interaction .

Site-directed mutagenesis of Lys271→Glu reduces activity by 90%, confirming its role in proton transfer . Structural modeling using Arabidopsis thaliana HMGR (PDB: 1TXY) predicts substrate docking geometry, with HMG-CoA’s thioester group oriented toward NADPH’s hydride donor site .

What evolutionary patterns explain the divergence of HMGR isoforms in Zea mays compared to other plants?

Phylogenetic analysis clusters Zea mays HMGR within monocot-specific Group III, distinct from dicot Groups I and II . Key evolutionary features include:

  • Gene duplication: Segmental duplication at 50–60 MYA produced paralogs ZmHMGR1 and ZmHMGR2, with 82% amino acid identity.

  • Subfunctionalization: ZmHMGR1 is ubiquitously expressed, while ZmHMGR2 is pollen-specific, reflecting neofunctionalization post-duplication .

  • Cis-regulatory elements: ZmHMGR1 promoters contain W-box motifs responsive to fungal elicitors, absent in ZmHMGR2 .

Ka/Ks ratios < 0.3 indicate strong purifying selection, preserving enzymatic function across Poaceae .

How can researchers troubleshoot low catalytic activity in recombinant HMGR preparations?

Common pitfalls and solutions include:

  • Improper folding: Refolding additives (2 mM β-cyclodextrin) during dialysis restore activity in 60% of cases .

  • Oxidative damage: Include 5 mM DTT in lysis buffers to protect catalytic cysteine residues .

  • Substrate inhibition: HMG-CoA concentrations >0.5 mM reduce velocity by 40%; optimize to 0.1–0.3 mM .

  • Allosteric regulation: Phosphomimetic mutations (Ser685→Asp) mimic phosphorylation, increasing Km by 3-fold .

Table 1: Recombinant HMGR Purification Metrics

ParameterValueSource
Expression HostE. coli BL21(DE3)
Yield0.5 mg/L culture
Purity (SDS-PAGE)>90%
Specific Activity50–75 nmol/min/mg
Optimal pH7.5

Table 2: Conserved Residues in Plant HMGRs

ResidueRoleConservation (%)
Lys271HMG-CoA binding98% (monocots)
Asp767Stabilizes enolate intermediate100%
Gly891NADPH coordination95%

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.