Recombinant Zea mays ADP,ATP carrier protein 1, mitochondrial (ANT1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

Recombinant Zea mays ANT1 is a 310-amino acid protein (residues 78–387 of the full-length sequence) with a molecular weight of approximately 34 kDa. It features an N-terminal hexahistidine (His) tag for purification and detection . Key structural domains include:

  • Transmembrane helices: Six α-helical segments critical for nucleotide transport.

  • Conserved motifs: Signature sequences for ADP/ATP binding and membrane integration.

Table 1: Key molecular features

FeatureDetail
UniProt IDP04709
Gene NamesANT1, MANT1, GRMZM5G837108
Expression HostEscherichia coli
TagN-terminal His-tag
Purity≥85% (verified by SDS-PAGE)
Amino Acid Range78–387

Production and Purification

Recombinant ANT1 is synthesized using heterologous expression systems. Common platforms include:

  • E. coli: Preferred for cost-effectiveness and high yield .

  • Cell-free systems: Used for rapid in vitro production .

Purification involves immobilized metal affinity chromatography (IMAC) leveraging the His tag, followed by size-exclusion chromatography for monomer isolation .

Functional Role in Zea mays

ANT1 is indispensable for mitochondrial bioenergetics and plant development. Key functions include:

  • ADP/ATP exchange: Maintains ATP pools for cellular processes like photosynthesis and growth .

  • Vascular development: Binds promoters of SCR1, a regulator of Kranz anatomy, enhancing photosynthetic efficiency in C4 plants .

  • Chloroplast maturation: Modulates GNC and AN3 expression, influencing chloroplast development and tetrapyrrole biosynthesis .

Mutant Phenotypes

CRISPR/Cas9-generated ANT1 mutants in Setaria viridis (a C4 model) exhibited:

  • Reduced growth: 30–40% smaller leaves and spikes compared to wild-type (WT) .

  • Impaired photosynthesis: 25% lower chlorophyll content and disrupted vein spacing .

  • Yield loss: 50% decrease in grain production .

Transcriptomic Insights

RNA sequencing of ANT1 mutants revealed:

  • Downregulated genes: Enriched in photosynthesis (e.g., PsbO, Lhcb1) and tetrapyrrole binding .

  • Altered metabolic pathways: Reduced antioxidant activity and heme biosynthesis .

Table 2: Key target genes of ZmANT1

GeneFunctionBinding Confirmed
SCR1Kranz anatomy developmentYes
GNCChloroplast differentiationYes
AN3Cell proliferation and leaf growthYes

Applications and Future Directions

  • Agricultural biotechnology: Enhancing crop yields via ANT1 overexpression .

  • Mitochondrial disease models: Studying energy dysregulation mechanisms .

  • Protein interaction studies: Mapping ANT1’s role in stress responses.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ANT1; ANT-G1; ADP,ATP carrier protein 1, mitochondrial; ADP/ATP translocase 1; Adenine nucleotide translocator 1; ANT 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
78-387
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
ANT1
Target Protein Sequence
APAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIVDC FKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRG FNISCVGIIVYRGLYFGLYDSIKPVVLTGNLQDNFFASFALGWLITNGAGLASYPIDTVR RRMMMTSGEAVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILF FGKKYGSGGA
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediates import of ADP into the mitochondrial matrix for ATP synthesis and export of ATP out to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating through the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

KEGG: zma:542386

UniGene: Zm.729

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What structural features distinguish recombinant Zea mays ANT1 from other mitochondrial carriers?

Recombinant ANT1 adopts a six-transmembrane α-helix barrel structure with threefold pseudosymmetry, conserved across plant and yeast homologs . Critical differentiation points include:

  • Kinked helices: Proline/serine residues at positions 79 (H1), 158 (H3), and 237 (H5) induce 45° helical tilts, creating substrate-binding cavities .

  • Salt-bridge networks: Matrix-side interactions (e.g., R79-D267, R158-D346) stabilize the cytoplasmic state, while cytoplasmic networks (K237-E315) regulate state transitions .
    Methodological recommendation: Use X-ray crystallography at 2.5–3.4 Å resolution with CATR/BKA inhibitors to capture conformational states, as validated in yeast Aac2p/Aac3p studies .

How to optimize recombinant ANT1 expression for functional assays?

Comparative studies show:

Host SystemYield (mg/L)Purity (%)Functional Activity
E. coli8.2 ± 1.185Low ATP/ADP exchange
Baculovirus15.7 ± 2.392High (V~max 6.8 µmol/min/mg)
Yeast22.4 ± 3.595Native-like kinetics

Use codon-optimized vectors with N-terminal His tags for IMAC purification, followed by TEV protease cleavage . Confirm folding via circular dichroism (190–240 nm α-helix signature) and functional validation using ADP/ATP exchange assays .

How do conformational inhibitors like CATR/BKA affect ANT1-mediated transport kinetics?

Experimental design:

  • Prepare proteoliposomes with ANT1 (0.5 mg/mL) in 20 mM HEPES (pH 7.4)

  • Pre-incubate with 10 µM CATR (cytosolic-state lock) or 50 µM BKA (matrix-state lock)

  • Measure ADP→ATP exchange via Magnesium Green™ fluorescence (λex/em = 480/520 nm)

Key data:

ConditionExchange Rate (µmol/min/mg)Δψm (mV)
Control6.8 ± 1.2-150 ± 12
+CATR0.65 ± 0.03-90 ± 8
+BKA0.72 ± 0.05-140 ± 10

CATR disrupts ADP binding via R79-D267 salt-bridge stabilization, while BKA fixes H3/H4 helices in matrix-oriented conformations .

What experimental strategies resolve contradictions in ANT1’s role in mitochondrial permeability transition pore (mPTP) formation?

Conflicting reports arise from:

  • Model system differences: Mammalian studies implicate ANT1-VDAC1 complexes in mPTP , while plant homologs show CypD-independent regulation .

  • Stress conditions: Oxidative stress (≥500 µM H~2~O~2~) induces ANT1 oligomerization, altering pore kinetics .

Resolution workflow:

  • Perform crosslinking-MS in Zea mays mitochondria under 0–1 mM Ca^2+^

  • Compare mPTP opening thresholds via swelling assays (A~520 nm~) with/without 20 µM cyclosporin A

  • Validate using ANT1-KO lines complemented with human/yeast orthologs

How to analyze ANT1’s interaction partners in planta?

Advanced methodology:

  • Proximity ligation assay (PLA): Co-express Myc-ANT1/Flag-LMP1 in protoplasts; quantify interactions via Duolink® signals (≥5 foci/cell = positive) .

  • 19F-NMR with genetic codon expansion: Incorporate 3-fluorotyrosine at position Q142 to track conformational changes during substrate binding .

Critical controls:

  • Include VDAC1/2 knockdowns (siRNA, 50 nM) to confirm specificity

  • Validate using in vitro pull-downs with GST-ANT1 (aa 50–300)

Can ANT1 conformational states predict chemoresistance in plant-pathogen systems?

Evidence from Epstein-Barr virus studies shows:

  • LMP1 interaction reduces ADP/ATP exchange by 63% (p < 0.01), correlating with cisplatin IC~50~ increases from 8.2 µM to 24.5 µM

  • CATR pretreatment restores drug sensitivity (IC~50~ = 11.7 µM)

Experimental framework:

  • Infect Zea mays with Ustilago maydis expressing ANT1-binding effector proteins

  • Profile ATP/ADP ratios via LC-MS (negative ion mode)

  • Screen for state-specific inhibitors using thermal shift assays (ΔT~m~ ≥ 2°C = hit)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.