Recombinant Zea mays ADP,ATP carrier protein 2, mitochondrial (ANT2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays ADP,ATP Carrier Protein 2, Mitochondrial (ANT2)

The Recombinant Zea mays ADP,ATP carrier protein 2, mitochondrial (ANT2), is a recombinant form of the adenine nucleotide translocase 2 protein found in maize (Zea mays). This protein plays a crucial role in the transport of ADP and ATP across the mitochondrial inner membrane, facilitating energy metabolism within cells. The recombinant version of this protein is often used in research to study mitochondrial function and energy transport mechanisms.

Structure and Function

The Recombinant Zea mays ADP,ATP carrier protein 2, mitochondrial (ANT2), is a full-length protein consisting of amino acids 78-387, with a His-tag attached for purification purposes . The protein is expressed in E. coli and is available in a lyophilized powder form. Its amino acid sequence is well-defined, which is crucial for understanding its structural and functional properties .

CharacteristicsDescription
SpeciesZea mays (Maize)
SourceE. coli
TagHis-tag
Protein Length78-387 amino acids
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Mechanism of Action

Mitochondrial ADP/ATP carriers, including ANT2, operate by cycling between two states: the cytoplasmic-open state, which accepts ADP from the cytosol, and the matrix-open state, which accepts ATP from the mitochondrial matrix . This alternating-access mechanism ensures efficient transport of ADP into the mitochondria for ATP synthesis and ATP out to the cytosol for cellular energy needs .

Research Findings and Applications

Research on ANT2 and similar proteins has highlighted their importance in cellular energy metabolism. Depletion of ANT2 in mice has been shown to impair erythropoiesis and B lymphocyte development, leading to severe metabolic defects . The recombinant ANT2 protein is used in various biochemical assays, such as SDS-PAGE, to study protein structure and function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ANT2; ANT-G2; ADP,ATP carrier protein 2, mitochondrial; ADP/ATP translocase 2; Adenine nucleotide translocator 2; ANT 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
78-387
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
ANT2
Target Protein Sequence
APAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIADC FKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRG FNISCVGIIVYRGLYFGLYDSIKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVR RRMMMTSGEAVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILF FGKKYGSGGA
Uniprot No.

Target Background

Function
ADP/ATP antiporter mediating ADP import into the mitochondrial matrix for ATP synthesis and ATP export to fuel cellular processes. It functions via an alternating access mechanism with a single substrate-binding site, cycling between cytoplasmic-open (c-state) and matrix-open (m-state) conformations within the inner mitochondrial membrane.
Database Links

KEGG: zma:542389

STRING: 4577.GRMZM2G135186_P03

UniGene: Zm.75

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Zea mays ANT2 and what is its primary function?

Zea mays ANT2 (adenine nucleotide translocase 2) is an inner mitochondrial membrane protein that mediates the exchange of cytosolic ADP with matrix ATP. This transport follows a strict 1:1 ratio, ensuring no net change in total nucleotide pool levels while facilitating the export of newly synthesized ATP to the cell and providing new ADP substrate to the mitochondria . ANT2 is central to maintaining energy homeostasis in plant cells, functioning through a mechanism similar to mammalian ANT proteins.

The primary functions of ANT2 include:

  • Facilitating ATP/ADP exchange across the inner mitochondrial membrane

  • Maintaining cellular energy homeostasis

  • Contributing to mitochondrial membrane potential regulation

  • Potentially participating in mitochondrial permeability transition processes

How does ANT2 differ from other ANT isoforms in structure and function?

ANT2 represents one of multiple ANT isoforms found in plants, similar to the isoform diversity observed in mammals. While specific structural differences between Zea mays ANT isoforms remain incompletely characterized, research on mammalian ANT proteins provides insight into potential functional distinctions.

Unlike ANT1, which is predominantly expressed in tissues with high energy demands in mammals, ANT2 shows broader tissue distribution and appears to have distinct roles in cellular physiology . Evidence from knockout studies suggests that ANT2 cannot be fully compensated for by other ANT isoforms, indicating unique functional properties .

Structurally, ANT proteins contain:

  • Six transmembrane domains that anchor the protein in the inner mitochondrial membrane

  • Specific binding sites for ADP and ATP

  • Exposed cysteine residues that can be modified to alter ATP/ADP exchange activity

What expression patterns does ANT2 show across different developmental stages in Zea mays?

The expression patterns of ANT2 in Zea mays vary across developmental stages and tissue types, though specific data from corn remains limited. By extrapolating from studies on other plant species and mammals, ANT2 expression is likely regulated by:

  • Tissue-specific energy demands

  • Developmental stage progression

  • Environmental stress conditions

  • Metabolic state of the plant

In mammals, ANT2 expression is crucial during embryogenesis and early development, with ANT2-depleted mice showing normal embryonic development but severe postnatal growth retardation . The plant ANT2 may show similar developmental regulation, with expression patterns potentially correlating with high energy-demanding processes during germination, growth, and reproduction.

What are the optimal methods for expressing and purifying recombinant Zea mays ANT2?

Successful expression and purification of recombinant Zea mays ANT2 requires careful consideration of expression systems, purification strategies, and protein stabilization methods:

Expression Systems:

  • E. coli: While commonly used, membrane proteins like ANT2 often form inclusion bodies, requiring refolding

  • Yeast expression systems: More suitable for membrane proteins, providing a eukaryotic environment with proper post-translational modifications

  • Insect cell systems: Optimal for complex membrane proteins, supporting proper folding and function

Purification Protocol:

  • Cell lysis using gentle detergents to preserve protein structure

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for further purification

  • Verification of proper folding using circular dichroism spectroscopy

  • Activity assessment through ADP/ATP exchange assays

Critical Parameters:

  • Detergent selection is crucial for maintaining ANT2 structure and function

  • Temperature control during purification steps (typically 4°C)

  • Addition of stabilizers such as glycerol (10-20%) in buffer solutions

  • Inclusion of protease inhibitors to prevent degradation

How can researchers assess the functional activity of recombinant ANT2?

Assessment of recombinant ANT2 functional activity can be performed through multiple complementary approaches:

ATP/ADP Exchange Activity Assays:

  • Reconstitution of purified ANT2 into liposomes

  • Measurement of 14C or 3H-labeled ADP/ATP transport across the liposomal membrane

  • Quantification of exchange rates under different conditions (pH, temperature, inhibitors)

Inhibitor Sensitivity Testing:

  • Bongkrekic acid (BKA): Potent inhibitor that locks ANT in m-state conformation

  • Carboxyatractyloside (CATR): Inhibitor that promotes c-state conformation

  • N-ethylmaleimide (NEM): Modifies cysteine residues and inhibits ATP/ADP exchange

Mitochondrial Membrane Potential Assays:

  • TMRM (tetramethyl rhodamine methyl ester) staining to assess membrane potential changes

  • Measurement of ANT2's impact on mitochondrial membrane potential in reconstituted systems

Functional Complementation:

  • Expression of recombinant Zea mays ANT2 in ANT-deficient yeast strains

  • Assessment of growth restoration and mitochondrial function

What experimental approaches are best for studying ANT2's role in mitochondrial permeability transition?

ANT proteins are implicated as potential components of the mitochondrial permeability transition pore (MPTP). Investigating this function in Zea mays ANT2 requires specialized techniques:

Mitochondrial Swelling Assays:

  • Isolation of intact mitochondria from plant tissues

  • Treatment with Ca2+ and other MPTP inducers

  • Measurement of light scattering to detect mitochondrial swelling

  • Assessment of ANT2-specific inhibitors on swelling kinetics

Calcium Retention Capacity:

  • Measurement of mitochondrial ability to sequester calcium before MPTP opening

  • Quantification of ANT2's contribution using specific inhibitors

  • Comparison of Ca2+ thresholds for MPTP induction in ANT2-depleted vs. control mitochondria

Reconstitution Studies:

  • Purified recombinant ANT2 can be reconstituted in proteoliposomes

  • Assessment of Ca2+-induced permeabilization in these artificial systems

  • Testing of cyclosporin A (CsA) sensitivity to determine CypD interaction

Protein Interaction Studies:

  • Co-immunoprecipitation of ANT2 with potential MPTP components

  • Analysis of ANT2 interactions with cyclophilin D (CypD) and voltage-dependent anion channel (VDAC)

  • Crosslinking experiments to capture transient interactions during MPTP formation

How does ANT2 depletion affect cellular metabolism and ATP production in plants?

Based on studies in mammalian systems, ANT2 depletion has significant impacts on cellular metabolism that can be assessed through the following approaches:

Metabolic Flux Analysis:

  • Measurement of glycolytic rates using extracellular acidification rate (ECAR)

  • Assessment of mitochondrial respiration through oxygen consumption rate (OCR)

  • Evaluation of maximal respiratory capacity after FCCP treatment

ATP Level Quantification:

  • Direct measurement of cellular ATP levels using luciferase-based assays

  • Analysis of ATP/ADP ratios in different cellular compartments

  • Assessment of changes in energy charge under stress conditions

Comparative Metabolic Profile:

ParameterNormal CellsANT2-Depleted CellsMethod of Measurement
Basal ECARNormalIncreasedSeahorse XF Analyzer
Maximal OCRNormalDecreasedAfter FCCP treatment
ATP LevelsNormalDecreasedLuciferase assay
ROS LevelsLowIncreasedFluorescent probes
Lactate ProductionNormalIncreasedEnzymatic assay

This metabolic shift suggests that ANT2 depletion forces cells to rely more heavily on glycolysis for ATP production while reducing mitochondrial respiratory capacity .

What controls are essential when working with recombinant ANT2?

Rigorous experimental controls are crucial for reliable ANT2 research:

Negative Controls:

  • Empty vector-transformed cells/plants

  • Inactive ANT2 mutants (e.g., cysteine mutants that disrupt function)

  • Heat-denatured recombinant protein for in vitro studies

Positive Controls:

  • Well-characterized ANT isoforms from model organisms

  • Known modulators of ANT function (BKA, CATR, NEM)

  • Reference proteins with established purification and activity profiles

Validation Controls:

  • Multiple methods to confirm protein expression (Western blot, mass spectrometry)

  • Functional complementation in ANT-deficient systems

  • Comparison of activity across different expression and purification batches

Statistical Considerations:

  • Minimum of three biological replicates for each experiment

  • Appropriate statistical tests based on experimental design

  • Power analysis to determine adequate sample sizes

How can contradicting data about ANT2 function be reconciled?

Contradictory findings regarding ANT2 function can arise from multiple sources. Researchers should consider:

Sources of Contradiction:

  • Different experimental systems (in vitro vs. in vivo)

  • Species-specific differences in ANT2 function

  • Variations in experimental conditions

  • Presence of compensatory mechanisms in genetic models

Reconciliation Approaches:

  • Systematic comparison of methodologies used in conflicting studies

  • Direct replication of key experiments with careful attention to experimental conditions

  • Meta-analysis of published data to identify patterns and sources of variation

  • Development of unified models that accommodate apparently contradictory observations

Critical Evaluation Framework:

  • Assess biological relevance of in vitro findings

  • Consider developmental and tissue-specific contexts

  • Evaluate genetic background effects in knockout/knockdown studies

  • Examine differences in post-translational modifications that might affect function

How can ANT2 be used to study mitochondrial function in crop improvement?

ANT2's central role in energy metabolism makes it valuable for understanding and improving crop performance:

Research Applications:

  • Development of ANT2 variants with optimized ATP/ADP exchange rates

  • Creation of plants with enhanced stress tolerance through ANT2 modification

  • Use of ANT2 as a marker for mitochondrial function under environmental stress

Methodological Approaches:

  • CRISPR/Cas9 editing of endogenous ANT2 genes

  • Overexpression or regulated expression of modified ANT2 variants

  • Creation of tissue-specific ANT2 expression systems

  • Development of ANT2 biosensors for real-time monitoring of mitochondrial function

What are the relationships between ANT2 function and reactive oxygen species (ROS) in plant cells?

ANT2 function is intimately connected with ROS production and management:

Experimental Evidence:

  • ANT2 depletion in mammalian cells leads to increased ROS levels

  • ROS can modify critical cysteine residues in ANT proteins, altering their function

  • Oxidative stress causes increased MPTP opening, which may involve ANT2

Measurement Approaches:

  • Fluorescent probes for ROS detection in ANT2-modified plant cells

  • Assessment of oxidative damage markers (lipid peroxidation, protein carbonylation)

  • Analysis of antioxidant enzyme responses (catalase, superoxide dismutase)

  • Measurement of glutathione redox state in response to ANT2 modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.