Recombinant Zea mays Aquaporin PIP1-3/PIP1-4 (PIP1-3; PIP1-4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag.
Synonyms
PIP1-3; PIP1-4; Aquaporin PIP1-3/PIP1-4; Plasma membrane intrinsic protein 1-3; Plasma membrane intrinsic protein 1-4; ZmPIP1-3; ZmPIP1-4; ZmPIP1;3;4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
PIP1-3;
Target Protein Sequence
MEGKEEDVRLGANKFSERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRAIPFKSRS
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the structural and functional characteristics of Zea mays Aquaporin PIP1-3/PIP1-4?

Aquaporins are integral membrane proteins that facilitate the transport of water and other small molecules across biological membranes. The Zea mays aquaporins PIP1-3 and PIP1-4 belong to the plasma membrane intrinsic protein (PIP) subfamily, which plays a critical role in regulating water permeability in plant cells. Structurally, these proteins consist of six transmembrane alpha-helices connected by five loops, with conserved NPA motifs forming the pore's selectivity filter. The recombinant versions of PIP1-3/PIP1-4 are expressed in E. coli systems and tagged with His for purification purposes .

How can recombinant PIP1-3/PIP1-4 be expressed and purified for experimental use?

Recombinant expression of PIP1-3/PIP1-4 typically involves cloning the gene sequence into a bacterial expression system such as E. coli. The protein is expressed as a fusion with an N-terminal His tag to facilitate purification via nickel affinity chromatography. The purified protein is often lyophilized into powder form for storage and reconstituted using sterile deionized water at concentrations ranging from 0.1–1.0 mg/mL .

To ensure functional integrity, researchers are advised to avoid repeated freeze-thaw cycles, store aliquots at -20°C or -80°C, and incorporate glycerol as a stabilizing agent during reconstitution . SDS-PAGE analysis confirms purity levels exceeding 90%, making these preparations suitable for downstream applications such as crystallization or functional assays.

What experimental methods can be used to study the water permeability of PIP aquaporins?

The water permeability of aquaporins like PIP1-3/PIP1-4 can be assessed using various experimental techniques:

Stopped-flow Spectrophotometry

This method involves rapid mixing of aquaporin-containing vesicles with an osmotic gradient solution, followed by measurement of light scattering changes due to water flux across the vesicle membrane. It provides quantitative data on osmotic permeability coefficients (pfp_f) .

Molecular Dynamics Simulations

Using computational tools such as AlphaFold2 for structural modeling and molecular dynamics simulations, researchers can analyze the conformational dynamics of aquaporins and their interactions with water molecules. These simulations reveal how pore radius variations affect water mobility along single-file channels .

Freeze-Thaw Assays

In yeast systems deficient in native aquaporins (aqy1/2 mutants), recombinant aquaporins can be expressed to measure survival rates post freeze-thaw treatment. Growth curves provide indirect insights into water transport efficiency .

Data from these methods highlight the interplay between protein structure, gating mechanisms, and environmental factors influencing aquaporin activity.

What role does heteromerization play in the function of PIP aquaporins?

Heteromerization between PIP1 and PIP2 aquaporins is essential for their trafficking to the plasma membrane and functional activation. Studies have shown that PIP1 aquaporins alone do not efficiently reach the plasma membrane but form heterotetramers with PIP2 aquaporins to enhance their activity . This interaction not only facilitates proper localization but also increases gating sensitivity under conditions such as cytosolic acidification.

How do environmental factors influence the activity of recombinant Zea mays Aquaporin PIP1-3/PIP1-4?

Environmental factors such as pH, ionic strength, and temperature significantly affect aquaporin activity:

pH Sensitivity

Cytosolic acidification alters gating mechanisms in PIP aquaporins by modulating conformational states that control pore opening . Experimental data suggest that random heterotetramerization between PIP1 and PIP2 enhances sensitivity to pH changes.

Temperature

Aquaporin functionality is temperature-dependent, with optimal activity observed within physiological ranges (20–30°C). Extreme temperatures may denature proteins or disrupt membrane integrity.

Ionic Strength

Ions such as calcium can act as regulators by binding to specific sites on aquaporins, influencing their gating properties and permeability rates.

These factors must be carefully controlled during experimental setups to ensure accurate measurements of aquaporin activity.

What are the challenges in interpreting contradictory data regarding aquaporin function?

Contradictory findings in aquaporin research often arise from differences in experimental design, expression systems, or analytical methods:

Expression Systems

Recombinant expression in bacterial systems may not fully replicate post-translational modifications present in native plant environments . This discrepancy can alter protein folding or functional properties.

Assay Variability

Different methods used to measure permeability (e.g., stopped-flow spectrophotometry vs molecular dynamics simulations) may yield varying results due to inherent methodological biases .

Environmental Conditions

Variations in pH, ionic strength, or temperature during experiments can lead to inconsistent observations regarding gating sensitivity or permeability rates .

Addressing these challenges requires standardized protocols and comparative analyses across multiple experimental platforms.

How can molecular dynamics simulations enhance our understanding of aquaporin function?

Molecular dynamics simulations provide detailed insights into the structural dynamics and intermolecular interactions governing aquaporin function:

By modeling the three-dimensional structure of recombinant PIP proteins using tools like AlphaFold2, researchers can simulate their behavior within lipid bilayers under physiological conditions . These simulations reveal how conformational changes in protein channels influence pore radius availability for water passage.

Additionally, hydrogen bonding patterns between water molecules and amino acid residues within the channel can be analyzed to understand mobility dynamics. Such computational approaches complement experimental data by offering atomistic-level explanations for observed phenomena.

What are potential applications of recombinant Zea mays Aquaporin PIP1-3/PIP1-4 in agricultural research?

The study of Zea mays aquaporins has implications for improving crop resilience under abiotic stress conditions:

Drought Tolerance

Aquaporins regulate water transport across cell membranes, making them critical targets for engineering drought-resistant crops through enhanced root water uptake mechanisms.

Salt Stress Adaptation

By modulating ionic permeability alongside water flux, aquaporins contribute to maintaining cellular homeostasis under high salinity conditions.

Nutrient Transport

Certain aquaporins facilitate the movement of small solutes like urea or boron, which are essential for plant growth and development .

These applications underscore the importance of understanding aquaporin function at both molecular and physiological levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.