Recombinant Zea mays Aquaporin PIP1-6 (PIP1-6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

PIP1-6 belongs to the PIP1 subclass, which requires heteromerization with PIP2 isoforms for plasma membrane (PM) localization and full activity . Functional studies reveal:

  • Trafficking Dependency: PIP1-6 relies on PIP2 partners (e.g., ZmPIP2;1, ZmPIP2;5) for ER export via COPII machinery and PM insertion .

  • Water Transport Enhancement: Coexpression with PIP2s increases membrane water permeability (P<sub>f</sub>) by 2.2-fold compared to PIP2 homotetramers .

  • pH Sensitivity: PIP1-PIP2 heterotetramers exhibit modified gating dynamics, with cytosolic acidification (pH ~6.5) reducing water flux .

Heteromerization Studies

PIP1-6 forms functional heterotetramers with PIP2s, as demonstrated in Xenopus oocytes and yeast systems . Key findings include:

Interacting PartnerFunctional EffectMethodReference
ZmPIP2;1/ZmPIP2;5Enables PM localization and enhances P<sub>f</sub>FRET/FLIM, BiFC
ZmSYP121Mediates post-Golgi traffickingAffinity purification
Rma1H1Ubiquitination-linked degradation regulationY2H, Pull-down

Biophysical Properties

  • Intrinsic Permeability: PIP1-6 alone shows no PM activity but exhibits high water conductance when coexpressed with PIP2s .

  • Regulatory Motifs: Diacidic motifs (Asp28, Glu31) and phosphorylation sites (Ser115, Arg118) govern trafficking and gating .

Comparative Analysis with Other Aquaporins

PIP1-6 shares ~80% sequence homology with other monocot PIP1s but diverges in trafficking motifs compared to PIP2s . Key distinctions:

FeaturePIP1-6PIP2 Isoforms
PM LocalizationRequires PIP2 coexpressionAutonomous
Conserved MotifsAbsence of LxxxA motif in TM3Contains LxxxA motif for ER export
pH SensitivityModulates PIP2 gating EC<sub>50</sub>Intrinsic pH sensing (His193 protonation)

Research Implications and Applications

Recombinant PIP1-6 is pivotal for:

  • Mechanistic Studies: Elucidating PIP1-PIP2 interactions, trafficking, and stress-responsive water transport .

  • Biotechnological Engineering: Improving crop drought tolerance via aquaporin modulation .

  • Structural Biology: Modeling hydrophobic gating mechanisms (e.g., Leu197 motion) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery information, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize development according to your specifications.
Synonyms
PIP1-6; Aquaporin PIP1-6; Plasma membrane intrinsic protein 1-6; ZmPIP1-6; ZmPIP1;6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
PIP1-6
Target Protein Sequence
MAGGTLQDRSEEEDVRVGVDRFPERQPIGTAADDLGRDYSEPPAAPLFEASELSSWSFYRAGIAEFVATFLFLYVTVLTVMGVSKSPSKCGTVGIQGIAWAFGGMIFALVYCTAGVSGGHINPAVTFGLLLARKLSLTRAVYYVVMQCLGAVCGAGVVKAFGSALYESAGGGANAVSPGYTKGDGLGAEVVGTFVLVYTVFSATDAKRTARDSHVPALAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYDNPHGWHGHWIFWVGPFAGAALAAVYHQVVLRAIPFKSSAHY
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Database Links

KEGG: zma:541887

STRING: 4577.GRMZM2G136032_P01

UniGene: Zm.604

Protein Families
MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic properties of Recombinant Zea mays Aquaporin PIP1-6?

Recombinant Zea mays Aquaporin PIP1-6 (PIP1-6) is a full-length protein (296 amino acids) belonging to the plasma membrane intrinsic protein family in maize. The protein is typically expressed with a His-tag when produced recombinantly in expression systems such as E. coli . Its amino acid sequence includes characteristic transmembrane domains and NPA motifs typical of aquaporins. The protein has a molecular weight consistent with other PIP family members and maintains the structural features necessary for forming water channels in the plasma membrane. PIP1-6 contains several conserved regions that are essential for its function in facilitating water transport across cellular membranes, including those involved in pore formation and gating .

How does PIP1-6 differ functionally from other PIP aquaporins in maize?

Unlike PIP2 subfamily members, PIP1-6 belongs to the PIP1 subfamily, which shows distinct functional characteristics. A critical difference is that PIP1 aquaporins, including PIP1-6, generally exhibit low or undetectable water transport activity when expressed alone in heterologous systems such as Xenopus oocytes . This contrasts with PIP2 aquaporins (like ZmPIP2;1, ZmPIP2;4, and ZmPIP2;5), which demonstrate significant water channel activity when expressed independently . The functional differences between these subfamilies are attributed to variations in amino acid sequences, particularly in loop regions and termini that affect channel gating, trafficking to the plasma membrane, and water conductance properties. PIP1 aquaporins require interaction with PIP2 members to exhibit full functionality in water transport .

What expression patterns does PIP1-6 show in different maize tissues and developmental stages?

The expression of PIP1-6, along with other PIP genes in maize, shows tissue-specific and developmentally regulated patterns. Generally, PIP1 expression is detected in both leaves and roots, though at different levels . In leaves, PIP1 expression is typically low at the base and gradually increases in the elongation zone (EZ), reaching peak expression where the leaf emerges from the sheath and becomes exposed to the atmosphere. This expression pattern correlates with increased evaporative demand from the xylem in these regions . Some PIP1 isoforms, such as PIP1;1 and PIP1;3, show plateaued or slightly decreased expression in the mature zone (MZ) of the leaf, while other isoforms like PIP1;2 and PIP1;6 may show different patterns . Expression levels also demonstrate diurnal variation, suggesting a role in the temporal regulation of plant water relations throughout the day-night cycle .

How is PIP1-6 involved in plant responses to water stress and environmental conditions?

Aquaporins, including PIP1-6, play crucial roles in plant responses to environmental stresses, particularly water deficit conditions. Studies have shown that PIP gene expression often changes in response to drought stress, though the specific patterns can vary between genotypes and species . In some poplar hybrids (P. simonii × balsamifera), certain PIP genes including a PIP1;3 homolog showed increased expression in response to water deficit conditions specifically in leaves, correlating with rapid reduction of stomatal conductance . This suggests that PIP1 aquaporins may be involved in adaptive responses to water stress. The regulation of PIP1-6 and other aquaporins during stress appears to be tissue-specific and coordinated with other physiological responses, potentially contributing to drought tolerance mechanisms by facilitating water movement or conservation depending on the specific stress conditions .

What mechanisms underlie the heteromerization of PIP1-6 with PIP2 aquaporins, and how does this affect membrane water permeability?

The heteromerization between PIP1 and PIP2 aquaporins represents a sophisticated regulatory mechanism for plant water transport. When PIP1 aquaporins like PIP1-6 are coexpressed with PIP2 aquaporins, they form heterotetramers with a random stoichiometric arrangement . This interaction is essential because PIP1 aquaporins typically cannot reach the plasma membrane independently and require PIP2 proteins for proper trafficking . The molecular basis for this interaction involves specific protein domains that facilitate oligomerization, particularly within the transmembrane regions and cytosolic loops of the proteins.

The functional consequences of this heteromerization are significant: not only does it enable PIP1-6 to contribute to membrane water permeability, but it also enhances the water transport activity of the associated PIP2 aquaporins . Experimental evidence from heterologous expression systems demonstrates that coexpression of PIP1 and PIP2 results in a synergistic increase in membrane water permeability (Pf) beyond what would be expected from simple additive effects . This suggests that the heteromerization induces conformational changes that optimize the water channel function of both components. Additionally, the interaction affects pH sensitivity and gating responses, providing plants with enhanced regulatory control over water flux in response to changing environmental conditions .

What role might PIP1-6 play in CO2 transport and photosynthetic efficiency in maize?

While PIP1-6 has been primarily studied for its role in water transport, emerging evidence suggests that certain aquaporins may also facilitate CO2 diffusion across plant membranes, with significant implications for photosynthetic efficiency. Although the specific CO2 permeability of PIP1-6 has not been definitively characterized, research on related aquaporins provides valuable insights.

Studies of other PIP aquaporins, particularly from the PIP2 subfamily (such as SiPIP2;7 from Setaria italica), have demonstrated significant CO2 permeability that enhances mesophyll conductance and photosynthetic performance . CO2 transport capability can be assessed using techniques such as membrane inlet mass spectrometry and expression in yeast systems co-transformed with human carbonic anhydrase II to ensure rapid CO2 hydration/dehydration .

For researchers investigating the potential CO2 transport function of PIP1-6, several approaches could be valuable:

  • Heterologous expression systems combining PIP1-6 with known CO2-permeable PIP2 aquaporins to examine if heteromerization affects CO2 transport capabilities

  • In vivo studies examining photosynthetic parameters in plants with altered PIP1-6 expression levels

  • Structural analysis of the pore region to identify amino acid residues that might facilitate or restrict CO2 passage

If PIP1-6 does contribute to CO2 transport, either directly or through interactions with PIP2 aquaporins, this would represent an additional mechanism by which these proteins influence plant productivity beyond their established role in water relations .

What are the genetic and environmental factors that regulate PIP1-6 expression in maize?

The regulation of PIP1-6 expression involves complex interactions between genetic and environmental factors. Recent research has identified expression quantitative trait loci (eQTLs) associated with aquaporin gene expression variability in maize . These regulatory elements can be categorized as either cis-acting (located near the gene they regulate) or trans-acting (located elsewhere in the genome).

Environmental factors significantly modulate PIP1-6 expression, including:

  • Water availability - drought conditions typically alter PIP expression patterns, though the direction of change (up or down-regulation) can be isoform-specific and may vary between tissues

  • Diurnal cycles - many PIP genes show rhythmic expression patterns over 24-hour periods, suggesting regulation by circadian mechanisms or direct responses to changing environmental conditions throughout the day-night cycle

  • Developmental cues - expression levels change along developmental gradients in organs like leaves, correlating with functional transitions from growing to mature tissues

  • Hormonal signals - plant hormones such as abscisic acid (ABA) play important roles in regulating aquaporin expression and activity, particularly during stress responses

The genetic architecture underlying this regulation includes promoter elements that respond to specific transcription factors, epigenetic modifications that influence chromatin accessibility, and potential post-transcriptional mechanisms involving microRNAs or RNA-binding proteins. Understanding these regulatory networks is essential for developing strategies to manipulate water use efficiency in crops through targeted modification of aquaporin expression patterns .

How does the cellular and subcellular localization of PIP1-6 affect its functional role in plant water relations?

The precise cellular and subcellular localization of PIP1-6 is critical to its functional role in plant water relations. Within leaf tissues, PIP aquaporins show cell type-specific expression patterns that facilitate water movement along specific pathways . For instance, PIP expression in vascular bundles and mesophyll cells supports radial water movement during evapotranspiration .

A key aspect of PIP1-6 functionality lies in its subcellular trafficking dynamics:

  • When expressed alone, PIP1 aquaporins like PIP1-6 often fail to reach the plasma membrane and remain trapped in intracellular compartments, explaining their lack of activity in some experimental systems

  • Coexpression with PIP2 aquaporins facilitates proper trafficking of PIP1-6 to the plasma membrane through direct protein-protein interactions

  • This trafficking mechanism represents an important regulatory layer controlling aquaporin activity in planta

The specific cellular contexts where PIP1-6 is expressed influence its functional significance. For example, different cell types may provide distinct protein interaction environments that affect heteromerization with PIP2 aquaporins. Additionally, cell-specific post-translational modifications may modulate PIP1-6 activity through phosphorylation, methylation, or other processes that affect channel gating or membrane residence time.

Researchers investigating PIP1-6 localization should consider employing techniques such as immunolocalization with isoform-specific antibodies, expression of fluorescently tagged proteins, or in situ hybridization to determine its spatial distribution patterns within plant tissues. Understanding these patterns is essential for interpreting the protein's role in whole-plant water transport and stress responses .

What expression systems are most effective for producing functional recombinant PIP1-6 for structural and functional studies?

Selecting the appropriate expression system is crucial for obtaining functional recombinant PIP1-6 for research purposes. Based on current literature, several systems offer distinct advantages:

  • E. coli expression system:

    • Commonly used for producing recombinant PIP1-6 with His-tags for purification

    • Advantages include high yield, cost-effectiveness, and established protocols

    • Limitations include potential improper folding of membrane proteins and lack of post-translational modifications

    • Most suitable for structural studies, antibody production, and basic biochemical characterization

  • Yeast expression systems:

    • Particularly useful for functional assays of water and CO2 permeability

    • The aqy1/2 double mutant yeast strain (deficient in endogenous aquaporins) provides a clean background for functional studies

    • Freeze-thaw survival assays in yeast offer a convenient method to quantify water permeability

    • Enables co-expression with other proteins (such as carbonic anhydrase) to study transport of multiple substrates

  • Xenopus oocyte expression:

    • Gold standard for functional characterization of aquaporins

    • Allows precise measurement of membrane water permeability through swelling assays

    • Particularly valuable for studying heteromerization by co-injecting cRNAs for multiple PIP isoforms

    • Enables electrophysiological measurements when studying potential ion conductance

When expressing PIP1-6, researchers should consider adding appropriate tags for detection and purification, optimizing codon usage for the expression host, and carefully selecting expression vectors with suitable promoters. For functional studies specifically investigating PIP1-6 in heteromeric complexes, co-expression with PIP2 aquaporins is essential due to the limited functionality of PIP1-6 alone .

What are the most reliable methods for assessing water and solute transport activity of PIP1-6 in various experimental systems?

Assessing the transport activity of PIP1-6 requires specialized techniques that accurately measure water and solute movement across membranes. The following methodologies have proven effective:

  • Swelling assays in Xenopus oocytes:

    • Oocytes expressing aquaporins are exposed to hypotonic medium, and the rate of swelling is measured

    • Changes in cell volume are monitored visually using video microscopy

    • Allows calculation of the osmotic water permeability coefficient (Pf)

    • Particularly useful for comparing PIP1-6 alone versus co-expression with PIP2 aquaporins

  • Freeze-thaw survival assays in yeast:

    • Based on the principle that aquaporin-expressing yeast shows improved survival after freeze-thaw cycles

    • Quantitative measure of functional water transport

    • Provides a relatively high-throughput method for screening multiple constructs

    • The aqy1/2 double mutant yeast strain offers an optimal background for these assays

  • Stopped-flow spectrophotometry with proteoliposomes:

    • Purified recombinant protein is reconstituted into liposomes

    • Rapid mixing with hyper/hypotonic solutions creates an osmotic gradient

    • Light scattering changes as liposomes shrink/swell

    • Allows precise biophysical characterization of transport kinetics

  • Membrane inlet mass spectrometry:

    • For assessing CO2 permeability of aquaporins

    • Measures the rate of CO2 movement across membranes in real-time

    • Can be used with yeast cells expressing PIP1-6 alone or in combination with PIP2 aquaporins

For reliable results, researchers should consider the following experimental factors:

  • Expression levels should be verified through Western blotting or fluorescence analysis

  • Membrane localization should be confirmed through confocal microscopy when using tagged constructs

  • Appropriate controls (non-functional aquaporins or empty vector controls) should be included

  • Temperature dependency of transport should be characterized to distinguish between channel-mediated and membrane diffusion components

What techniques are available for studying PIP1-6 interactions with other aquaporins and membrane proteins?

Understanding the interactions between PIP1-6 and other proteins, particularly PIP2 aquaporins, is essential for elucidating its functional role. Several complementary techniques can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Utilizes antibodies against one protein to pull down interaction partners

    • Can be performed with tagged recombinant proteins or endogenous proteins from plant tissues

    • Western blotting confirms the presence of interacting partners

    • Particularly useful for verifying PIP1-6 interactions with specific PIP2 isoforms

  • Förster Resonance Energy Transfer (FRET):

    • Involves tagging potential interaction partners with donor and acceptor fluorophores

    • Energy transfer occurs only when proteins are in close proximity (typically <10 nm)

    • Can be performed in living cells to study dynamic interactions

    • Useful for mapping domains involved in PIP1-PIP2 heteromerization

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments are fused to potential interaction partners

    • Fluorescence occurs only when fragments are brought together by protein-protein interaction

    • Provides spatial information about interaction sites within cells

    • Well-suited for confirming interactions in plant cells

  • Yeast Two-Hybrid (Y2H) adaptations for membrane proteins:

    • Modified Y2H systems designed specifically for membrane proteins

    • Split-ubiquitin Y2H allows detection of interactions between membrane proteins

    • Useful for screening potential interaction partners of PIP1-6

  • Mass spectrometry-based approaches:

    • Crosslinking mass spectrometry can identify interaction interfaces

    • Affinity purification coupled with mass spectrometry identifies interaction networks

    • Label-free quantification provides information about interaction stoichiometry

    • Particularly valuable for discovering novel PIP1-6 interacting proteins

For studying the specific heteromerization between PIP1-6 and PIP2 aquaporins, experimental designs should account for the random stoichiometric arrangement of subunits in the tetrameric complexes . Mathematical modeling approaches can complement these experimental techniques by predicting the functional consequences of different interaction scenarios, helping to interpret complex experimental results .

How can PIP1-6 research contribute to improving crop water use efficiency and drought tolerance?

Research on PIP1-6 and related aquaporins holds significant potential for enhancing crop performance under water-limited conditions. Understanding the molecular mechanisms of PIP1-6 function could enable several targeted approaches:

  • Genetic engineering strategies:

    • Modifying PIP1-6 expression levels in specific tissues or developmental stages could optimize plant water relations

    • Engineering PIP1-6 variants with altered gating properties might improve regulation of water transport under stress

    • Manipulating the ratio of PIP1 to PIP2 aquaporins could enhance water transport efficiency through optimized heteromerization

  • Marker-assisted breeding applications:

    • Identifying natural variation in PIP1-6 sequence or expression associated with drought tolerance

    • Using eQTLs (expression Quantitative Trait Loci) related to PIP gene expression as markers for selection in breeding programs

    • Developing high-throughput screening methods to identify germplasm with optimal PIP expression patterns

  • Phenotyping approaches:

    • Developing methods to measure tissue-specific hydraulic conductivity as a proxy for aquaporin function in intact plants

    • Correlating PIP1-6 expression patterns with whole-plant physiological responses to water deficit

    • Using these relationships to predict drought performance in diverse germplasm

The unique properties of PIP1-6, particularly its interaction with PIP2 aquaporins to form heteromeric channels with enhanced water permeability, provide a potential lever for manipulating plant water relations . By fine-tuning these interactions, researchers may develop crops with improved water uptake efficiency during well-watered conditions and better water conservation during drought. Additionally, if PIP1-6 plays a role in CO2 transport, similar to some other aquaporins , manipulating its expression could potentially enhance photosynthetic efficiency alongside water use optimization.

What is the potential role of PIP1-6 in facilitating nutrient transport and mineral homeostasis in plants?

Beyond water transport, emerging evidence suggests that aquaporins may play multifaceted roles in nutrient acquisition and homeostasis. While specific data on PIP1-6's role in nutrient transport is limited, research on related aquaporins provides a framework for investigation:

  • Potential nutrient transport functions:

    • Some aquaporin subfamilies (particularly NIPs) transport boron, silicon, and other minerals

    • Though PIP aquaporins primarily transport water, their potential role in facilitating the movement of small neutral molecules like boric acid warrants investigation

    • PIP1-6 might influence nutrient availability indirectly by affecting root hydraulics and the soil-plant-water continuum

  • Interaction with nutrient transporters:

    • PIP1-6 might physically or functionally interact with dedicated nutrient transporters

    • Colocalization studies could reveal potential coordination between water and nutrient transport systems

    • Changes in PIP1-6 expression in response to nutrient deficiency would suggest involvement in adaptive responses

  • Contribution to nutrient transport at the tissue level:

    • Water flow facilitated by PIP1-6 may drive mass flow of nutrients in the xylem

    • Tissue-specific expression patterns might correlate with sites of active nutrient loading or unloading

    • Integration of water and nutrient transport would allow coordinated responses to environmental changes

Research approaches to investigate these possibilities could include:

  • Examining the effects of varying nutrient conditions on PIP1-6 expression and localization

  • Testing transport capabilities for various nutrients in heterologous expression systems

  • Evaluating nutrient uptake and distribution in plants with altered PIP1-6 expression

  • Investigating potential interactions between PIP1-6 and known nutrient transporters

Understanding the multifunctional nature of PIP1-6 could open new avenues for improving not only water use efficiency but also nutrient acquisition efficiency in crops, addressing multiple constraints to agricultural productivity simultaneously .

How might emerging structural biology techniques enhance our understanding of PIP1-6 function and regulation?

Recent advances in structural biology techniques offer unprecedented opportunities to elucidate the molecular details of PIP1-6 function and regulation:

  • Cryo-electron microscopy (cryo-EM):

    • Enables determination of near-atomic resolution structures of membrane proteins in native-like environments

    • Could reveal the structural basis for PIP1-PIP2 heteromerization

    • May capture different conformational states related to channel gating

    • Potential to visualize PIP1-6 in complex with regulatory proteins

  • X-ray crystallography of membrane proteins:

    • Continues to improve with better crystallization methods for membrane proteins

    • Could provide high-resolution structures of PIP1-6 alone or in complex with PIP2 aquaporins

    • May reveal water or substrate binding sites within the channel pore

  • Molecular dynamics simulations:

    • Can model water movement through PIP1-6 channels at the atomic level

    • Allows testing hypotheses about channel selectivity and gating mechanisms

    • Particularly valuable when integrated with experimental structural data

    • Could predict effects of mutations or post-translational modifications

  • Single-particle tracking and super-resolution microscopy:

    • Enables visualization of individual PIP1-6 proteins in living cells

    • Could reveal dynamic aspects of trafficking and membrane organization

    • May identify clustering or segregation of different PIP isoforms in membrane microdomains

    • Provides insights into the dynamics of channel assembly and disassembly

  • Mass spectrometry-based structural proteomics:

    • Hydrogen-deuterium exchange mass spectrometry can identify dynamic regions and ligand binding sites

    • Cross-linking mass spectrometry can map protein interaction interfaces

    • Can identify post-translational modifications that regulate channel activity

These techniques, especially when used in combination, have the potential to answer key questions about PIP1-6:

  • How does the molecular structure of PIP1-6 differ from PIP2 aquaporins at the atomic level?

  • What structural changes occur during heteromerization that enhance water transport activity?

  • How do post-translational modifications alter channel structure and function?

  • What is the structural basis for differential trafficking of PIP1 and PIP2 aquaporins?

Addressing these questions would significantly advance our understanding of plant water relations at the molecular level and inform strategies for crop improvement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.