Recombinant Zea mays Aquaporin TIP1-2 (TIP1-2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant ZmTIP1-2 is a 254-amino acid protein (UniProt ID: Q9ATM0) expressed in E. coli with an N-terminal His tag for purification . Key molecular features include:

PropertyDetails
Gene NameTIP1-2
SynonymsZmTIP1-2, Tonoplast intrinsic protein 1-2
Molecular Weight~25.8 kDa (calculated from sequence)
Sequence MotifsMIP family signature SGxHxNPAVT, mercury-sensitive Cys residue (Cys-118)
Structural DomainsSix transmembrane helices, cytoplasmic N- and C-termini
Expression SystemE. coli
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Properties

ZmTIP1-2 belongs to the tonoplast-intrinsic aquaporin subfamily and facilitates water transport across vacuolar membranes. Key functional insights include:

Water Channel Activity

  • Increases osmotic water permeability 5-fold in Xenopus laevis oocytes .

  • Mercury-sensitive: 70% inhibition with 3 mM HgCl₂ .

  • pH-dependent gating mediated by conserved His residues in cytoplasmic loops .

Cellular Roles

  • Vacuole Biogenesis: Highly expressed in root meristems and expanding cells, supporting vacuole formation during cell division .

  • Cell Expansion: Modulates water influx into vacuoles to drive turgor pressure .

  • Nutrient Transport: May facilitate boron uptake, critical for cell wall integrity .

Biochemical Interactions

ZmTIP1-2 interacts with multiple proteins regulating its trafficking and activity:

Interacting ProteinFunctionMethodReference
ZmSYP121Syntaxin mediating post-Golgi traffickingBiFC, Split-Ub
Rma1H1E3 Ub ligase for degradation regulationY2H, Pull-down
COPII complexER export via diacidic motifsMutational analysis

Expression and Localization

  • Tissue Specificity: Ubiquitous in roots, leaves, and reproductive organs, with peak expression in meristems .

  • Subcellular Localization: Tonoplast of vacuoles, confirmed by immunogold labeling .

  • Developmental Regulation:

    • Upregulated during seed germination and lateral root emergence .

    • Replaced by TIP3 isoforms in mature seeds .

Plant Physiology Studies

  • Root Development: Disruption of ZmTIP1-2 delays lateral root emergence by altering water flow dynamics .

  • Stress Responses: Overexpression enhances drought tolerance in transgenic plants by improving hydraulic conductivity .

Biotechnological Utility

  • Protein Engineering: Used to study mercury-sensitive residues and pH-gating mechanisms .

  • Agricultural Research: Targeted in maize breeding programs to improve water-use efficiency .

Key Research Findings

  • Structural Basis: Leu197 in cytoplasmic loop D acts as a hydrophobic gate controlling water permeability .

  • Mutant Phenotypes:

    • zmtip1-2 mutants show reduced seedling growth and protein content in seeds .

    • Altered root architecture due to impaired vacuolar expansion .

Future Directions

  • Elucidate phosphorylation sites (e.g., Ser-115, Arg-118) regulating subcellular trafficking .

  • Explore roles in CO₂ and nutrient transport beyond water .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
TIP1-2; Aquaporin TIP1-2; Tonoplast intrinsic protein 1-2; ZmTIP1-2; ZmTIP1;2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
TIP1-2
Target Protein Sequence
MPVSRIAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTTAADY
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Database Links

KEGG: zma:541893

STRING: 4577.GRMZM2G168439_P01

UniGene: Zm.612

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the structural classification of Zea mays Aquaporin TIP1-2?

Zea mays Aquaporin TIP1-2 belongs to the Tonoplast Intrinsic Protein (TIP) subfamily of aquaporins, specifically the TIP1 group. Like other aquaporins, it features six transmembrane domains with five connecting loops and cytosolic N- and C-termini. The protein contains the characteristic NPA (Asparagine-Proline-Alanine) motifs in loops B and E that form the water-selective filter. These structural elements can be analyzed using transmembrane domain prediction tools like TMHMM server as well as tertiary structure prediction software like PSIPRED . The ar/R (aromatic/arginine) selectivity filter, composed of four residues from transmembrane helices H2 and H5 and loops LE1 and LE2, determines substrate specificity beyond water transport .

How does the expression pattern of TIP1-2 compare to other aquaporins in Zea mays?

While the search results don't provide specific expression data for Zea mays TIP1-2, comparative studies in related plant species like melon (Cucumis melo) show that TIP1 subfamily members typically demonstrate tissue-specific expression patterns. For example, in melon, TIP1;1 shows the highest expression among all aquaporins in both root and leaf tissues, particularly in leaves . To accurately determine the expression pattern of Zea mays TIP1-2, RT-qPCR analysis should be performed across various tissues and developmental stages. When analyzing expression data, it's recommended to normalize against appropriate reference genes (such as RAN) and present results as relative units compared to the most highly expressed aquaporin for contextual understanding .

What are the functional properties of recombinant TIP1-2 protein?

Recombinant TIP1-2, when properly expressed and purified, maintains its functional properties as a transmembrane channel protein. Similar to other TIP subfamily members, TIP1-2 likely facilitates the transport of water and possibly small solutes across tonoplast membranes. The functional characterization typically involves reconstitution in proteoliposomes or expression in heterologous systems like Xenopus oocytes to measure water permeability coefficients. The substrate specificity can be predicted by analyzing conserved amino acid residues in the ar/R selectivity filter and through comparison with functionally characterized orthologues from Arabidopsis thaliana, rice (Oryza sativa), and maize (Zea mays) . Transport capabilities may include water, hydrogen peroxide, ammonia, or other small uncharged molecules depending on the specific structure of the pore region.

What expression system is optimal for producing recombinant Zea mays TIP1-2?

E. coli is the most commonly used expression system for recombinant plant aquaporins, including Zea mays TIP1-2. Based on established protocols for similar aquaporins, the protein can be produced as a full-length construct (typically comprising approximately 240-260 amino acids) fused to an N-terminal His-tag to facilitate purification . The expression construct should be designed to optimize codon usage for bacterial expression while maintaining the complete functional protein. Alternative expression systems such as yeast (Pichia pastoris) or insect cells may provide better protein folding for functional studies but generally yield lower protein quantities. When expressing membrane proteins like aquaporins in E. coli, it's critical to optimize induction conditions (temperature, IPTG concentration, and induction time) to balance between protein yield and proper folding.

What purification strategy yields the highest purity and activity for recombinant TIP1-2?

A multi-step purification approach is recommended for recombinant TIP1-2. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) serves as the initial purification step . The protein should be solubilized from inclusion bodies or membranes using appropriate detergents (typically n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside) at concentrations above their critical micelle concentration. Following IMAC, size exclusion chromatography further improves purity by separating monomeric/tetrameric aquaporin from aggregates. The purified protein is typically obtained as a lyophilized powder and should be stored at -20°C/-80°C . For reconstitution, the protein should be dissolved in an appropriate buffer (Tris/PBS-based, pH 8.0) to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability . Purity greater than 90% as determined by SDS-PAGE is generally suitable for most research applications .

How can I verify the proper folding and functional activity of purified TIP1-2?

Verification of proper folding and functional activity of purified TIP1-2 requires multiple complementary approaches. Circular dichroism (CD) spectroscopy can confirm the presence of the expected secondary structure elements (predominantly α-helical). To assess functional activity, the purified protein should be reconstituted into proteoliposomes for water transport assays using stopped-flow spectroscopy to measure the rate of liposome shrinkage or swelling in response to osmotic gradients. Additionally, intrinsic fluorescence spectroscopy can provide information about the tertiary structure by monitoring the fluorescence of tryptophan residues in different environments. For more detailed structural analysis, crystallization trials or cryo-electron microscopy could be pursued, though aquaporins can be challenging to crystallize due to their membrane protein nature. The functional residues involved in transport specificity should be identified through alignment with well-characterized aquaporins, focusing on the NPA motifs, ar/R filters, and Froger's positions (P1-P5) .

How can site-directed mutagenesis of TIP1-2 elucidate structure-function relationships?

Site-directed mutagenesis of key residues in TIP1-2 provides valuable insights into structure-function relationships. Priority targets for mutation include residues in the NPA motifs, which are critical for water selectivity, and the ar/R selectivity filter, which determines substrate specificity. Based on comparative analyses with other plant aquaporins, mutations in these regions can alter transport selectivity and efficiency . For example, modifying residues in the ar/R filter might change selectivity from water to other substrates like hydrogen peroxide or ammonia. When designing mutagenesis experiments, it's crucial to first identify conserved and variable residues through multiple sequence alignments with functionally characterized aquaporins from model plants. The mutated proteins should be subjected to the same purification and functional characterization as the wild-type protein to assess the impact of mutations. Water and solute transport assays in reconstituted proteoliposomes or heterologous expression systems can quantify changes in transport properties. Combining experimental data with molecular dynamics simulations can further illuminate how specific residues contribute to pore architecture and substrate selectivity.

What techniques are most effective for studying TIP1-2 localization and trafficking in plant cells?

Studying TIP1-2 localization and trafficking in plant cells requires a combination of molecular biology and advanced microscopy techniques. For subcellular localization, prediction tools like Plant-mPLoc and WoLF PSORT provide initial insights , but experimental validation is essential. Fluorescent protein fusions (GFP, YFP, or mCherry) can be created at either the N- or C-terminus of TIP1-2, though care must be taken to ensure the tag doesn't disrupt protein folding or trafficking signals. These constructs can be transiently expressed in plant protoplasts or stably transformed into plant tissues for visualization by confocal microscopy. Co-localization with established organelle markers (particularly tonoplast markers) confirms the expected vacuolar membrane localization typical of TIP aquaporins. For dynamic trafficking studies, techniques like fluorescence recovery after photobleaching (FRAP) or photoactivatable fluorescent proteins can track protein movement within cells. To study protein-protein interactions that might influence localization, approaches such as bimolecular fluorescence complementation (BiFC), Förster resonance energy transfer (FRET), or co-immunoprecipitation can be employed. For higher resolution imaging, super-resolution microscopy techniques like STORM or PALM may reveal nanoscale organization patterns at the tonoplast.

How does TIP1-2 compare structurally and functionally to other aquaporin subfamilies?

TIP1-2 belongs to the Tonoplast Intrinsic Protein subfamily, which differs from other aquaporin subfamilies (PIPs, NIPs, SIPs, and XIPs) in several key aspects. Structurally, TIPs share the conserved aquaporin fold with six transmembrane domains but differ in the composition of the ar/R selectivity filter and Froger's positions that determine substrate specificity . While PIPs primarily transport water and are located in the plasma membrane, TIPs like TIP1-2 reside in the tonoplast and often show broader substrate specificity, potentially transporting ammonia, hydrogen peroxide, and other small uncharged molecules in addition to water. This functional diversity can be analyzed by examining the amino acid composition at key positions in the protein sequence. The ar/R filter positions (H2, H5, LE1, LE2) and Froger's positions (P1-P5) should be specifically examined, as these determine transport selectivity . Phylogenetic analysis using software like Mega X with the MUSCLE algorithm for alignments can further elucidate evolutionary relationships between TIP1-2 and other aquaporins . Comparative 3D structure modeling can visualize differences in pore architecture and provide insights into functional divergence between aquaporin subfamilies.

What computational tools are most useful for analyzing TIP1-2 sequence and structure?

A comprehensive computational analysis of TIP1-2 requires multiple specialized tools. For basic protein property analysis, Expasy's ProtParam tool can calculate isoelectric point (pI) and molecular weight . Transmembrane domain prediction is best performed using the TMHMM server, which accurately identifies the six transmembrane helices characteristic of aquaporins . For motif identification, the MEME web server can locate conserved sequence patterns including the NPA motifs critical for aquaporin function . Subcellular localization prediction tools like Plant-mPLoc and WoLF PSORT provide complementary approaches to predict the tonoplast localization typical of TIPs . For tertiary structure prediction, the PSIPRED server generates reliable protein models that can be further refined . Sequence alignments should be performed using the MUSCLE algorithm implemented in Mega X software, particularly when comparing TIP1-2 with other aquaporin family members to identify conserved functional residues . For more detailed structural analysis, molecular dynamics simulations can model water and solute movement through the pore. When analyzing the pore structure specifically, programs like HOLE or MOLEonline can calculate pore dimensions and identify constriction points that might influence substrate selectivity. For evolutionary analysis, tools like PAML can detect signatures of positive selection that might indicate functional adaptation.

What are common issues in recombinant TIP1-2 expression and how can they be resolved?

Recombinant expression of membrane proteins like TIP1-2 presents several challenges. One common issue is protein aggregation and inclusion body formation in E. coli. This can be mitigated by lowering the induction temperature (16-20°C), reducing IPTG concentration, or using E. coli strains specifically designed for membrane protein expression (C41/C43). Poor protein yield may result from codon bias; using codon-optimized sequences for E. coli can significantly improve expression levels. For proteins expressed as inclusion bodies, optimization of solubilization conditions is critical, typically requiring screening of different detergents and buffer compositions. Protein instability during purification can be addressed by including glycerol (5-50%) in all buffers and minimizing freeze-thaw cycles . Poor affinity purification may result from tag inaccessibility; switching the tag position from N-terminal to C-terminal might improve purification efficiency. For functional studies, improper refolding after purification is a common issue. This can be addressed through careful optimization of reconstitution protocols, including detergent removal methods like dialysis or bio-beads. Quality control checkpoints should include SDS-PAGE analysis to verify protein integrity and purity (>90%) , Western blotting with anti-His antibodies to confirm identity, and functional assays to verify activity.

How can heterogeneity in TIP1-2 samples be assessed and minimized?

Heterogeneity in recombinant TIP1-2 samples can arise from multiple sources and must be carefully managed for reliable experimental results. Size exclusion chromatography (SEC) is essential for assessing sample homogeneity, distinguishing between monomeric, tetrameric, and aggregated forms of the protein. Dynamic light scattering (DLS) provides complementary information about size distribution and potential aggregation. Protein purity should be verified by SDS-PAGE with both Coomassie staining and silver staining to detect low-abundance contaminants . For detailed heterogeneity analysis, mass spectrometry can identify post-translational modifications, truncations, or other protein variants. To minimize heterogeneity during purification, optimize buffer conditions (pH, salt concentration, detergent type) through systematic screening. After purification, the lyophilized protein should be reconstituted according to standardized protocols to ensure consistent results across experiments . For storage, aliquot the protein to avoid repeated freeze-thaw cycles, and maintain consistent buffer conditions with 5-50% glycerol as a stabilizing agent . When reconstituting lyophilized protein, centrifuge the vial briefly to collect all material at the bottom before adding the reconstitution buffer, and dissolve to a defined concentration (0.1-1.0 mg/mL) . For long-term storage, maintain samples at -80°C with proper documentation of freeze-thaw history.

What controls are essential when performing functional assays with recombinant TIP1-2?

Rigorous controls are essential for reliable functional characterization of recombinant TIP1-2. For water transport assays in proteoliposomes, empty liposomes (without incorporated protein) provide the baseline permeability measurement. A well-characterized aquaporin with known water permeability (such as human AQP1 or PIP2;1 from Arabidopsis) serves as a positive control to validate the assay system. For substrate specificity studies, include both positive controls (proteins known to transport the substrate of interest) and negative controls (proteins known not to transport the substrate). When performing site-directed mutagenesis, wild-type TIP1-2 must be processed in parallel with mutant variants to provide direct comparison under identical conditions. For expression studies comparing TIP1-2 levels across conditions or tissues, include multiple reference genes that have been validated for stability under the specific experimental conditions . Statistical validation requires multiple biological replicates (3-6 independent samples) and technical replicates (typically in triplicate) for all quantitative measurements . When analyzing expression data, appropriate statistical tests must be applied, such as Student's t-test for two-condition comparisons or ANOVA followed by post-hoc tests for multiple conditions . For all functional assays, temperature, pH, and osmotic conditions must be carefully controlled and reported to ensure reproducibility across laboratories.

How might TIP1-2 contribute to drought tolerance mechanisms in maize?

TIP1-2, as a tonoplast aquaporin, likely plays a significant role in cellular water homeostasis during drought stress in maize. The protein would facilitate water movement between the cytosol and vacuole, potentially contributing to osmotic adjustment mechanisms. To investigate this role, comprehensive expression analysis across different tissues (roots, leaves, stems) under progressive drought conditions is essential, using RT-qPCR with specific primers designed in non-coding regions to avoid cross-amplification with other aquaporin family members . For mechanistic understanding, create transgenic maize lines with altered TIP1-2 expression (overexpression and knockdown/knockout) and assess their physiological responses to drought, including measurements of relative water content, leaf water potential, stomatal conductance, and photosynthetic parameters. Subcellular localization studies using GFP fusion proteins can reveal whether TIP1-2 shows stress-induced relocalization, which might indicate functional adaptations. Proteomic analysis of protein abundance and post-translational modifications (especially phosphorylation, which regulates aquaporin activity) during drought will provide insights into post-transcriptional regulation mechanisms. For translational applications, compare TIP1-2 sequence, expression, and regulation between drought-tolerant and drought-sensitive maize varieties to identify potential targets for breeding or genetic engineering approaches aiming to enhance drought resilience.

What methods can be used to study the interaction between TIP1-2 and other membrane proteins in planta?

Studying protein-protein interactions involving membrane proteins like TIP1-2 in planta requires specialized approaches. Co-immunoprecipitation (Co-IP) using antibodies against TIP1-2 or an epitope tag, followed by mass spectrometry analysis, can identify interacting proteins in native complexes. For visualization of interactions, bimolecular fluorescence complementation (BiFC) involves fusing complementary fragments of a fluorescent protein to potential interaction partners, with fluorescence occurring only when proteins interact closely. Förster resonance energy transfer (FRET) or fluorescence lifetime imaging microscopy (FLIM) provides quantitative measurement of protein proximity in living cells. To validate direct interactions, split-ubiquitin membrane yeast two-hybrid systems are specifically designed for membrane protein interactions. Advanced imaging approaches like proximity ligation assay (PLA) can detect protein interactions with high sensitivity in fixed tissue samples. For functional relevance, combining interaction studies with physiological measurements can reveal how protein complexes contribute to cellular processes. When designing these experiments, it's important to consider that membrane protein interactions may be transient or dependent on specific environmental conditions or developmental stages. Analysis of co-expression patterns across tissues and conditions can provide initial indications of potential interaction partners worth investigating experimentally. Ultimately, integrating multiple complementary approaches is necessary for a comprehensive understanding of TIP1-2 interaction networks and their physiological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.