Recombinant Zea mays Aquaporin TIP2-1 (TIP2-1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Zea mays Aquaporin TIP2-1 (TIP2-1)

Recombinant Zea mays Aquaporin TIP2-1 (TIP2-1) is a full-length transmembrane protein derived from maize (Zea mays), engineered for research applications. It belongs to the Tonoplast Intrinsic Protein (TIP) subfamily of aquaporins, which facilitate water and solute transport across membranes. The recombinant form is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Expression and Purification

ParameterDetails
SourceExpressed in E. coli via recombinant DNA technology
TagN-terminal His-tag (10xHis in some variants)
Protein LengthFull-length (1–249 amino acids)
Purity>90% (SDS-PAGE analysis)
StorageLyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

The protein retains its functional integrity post-reconstitution, as confirmed by structural and permeability assays .

Ammonia and Water Permeability

TIP2-1 is permeable to both water and ammonia, with selectivity influenced by SF residues:

  • Ammonia transport: Requires specific hydrogen-bonding interactions between pore residues and NH₃ molecules .

  • Water permeability: Governed by pore size and water-pore interactions. Mutations (e.g., I185H/G194C) reduce ammonia permeability without affecting water flux .

Chloroplast Osmoregulation

In Arabidopsis thaliana, TIP2-1 localizes to thylakoid membranes and regulates:

FunctionMechanism
Thylakoid volume changesFacilitates rapid water influx during light-induced acidification
Photosynthetic efficiencyMaintains ΔpH-dependent photoprotection; mutants show reduced NPQ induction
CO₂ fixationOptimizes electron transport rates for Calvin cycle activity

Lateral Root Emergence

TIP2-1 modulates water transport in lateral root primordia (LRPs):

  • Spatial regulation: Required at the base and flanks of developing LRPs to enable emergence .

  • Rescue experiments: AtTIP2;1 expression restores lateral root formation in triple tip mutants .

Role in Flowering

Highly conserved in angiosperms, TIP2-1 homologs are upregulated during floret opening in monocots (e.g., maize, rice) and eudicots (e.g., cotton, tomato) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIP2-1; TIP2A; Aquaporin TIP2-1; Tonoplast intrinsic protein 2-1; ZmTIP2-1; ZmTIP2;1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
TIP2-1
Target Protein Sequence
MVKLAFGSVGDSFSATSIKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIAIAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGVFYWVAQLLGATVACLLLGFVTHGKAIPTHAVAGISELEGVVFEVVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGDFAGNWVYWVGPLVGGGLAGLVYGDVFIGGSYQQVADQDYA
Uniprot No.

Target Background

Function

Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Aquaporin TIP2-1 and what is its primary function in plants?

Aquaporin TIP2-1 is a tonoplast intrinsic protein found in the membrane surrounding the vacuole organelle of plant cells. It functions as a channel protein permeable to both water and ammonia, facilitating their transport across the vacuolar membrane . TIP2-1 shares structural features with other ammonia-permeable aquaporins, including the mammalian AQP8, particularly in the selectivity filter (SF) composition consisting of H63, I185, G194, and R200 residues (using TIP2;1 residue IDs) .

How does the structure of TIP2-1 relate to its function?

The crystal structure of TIP2-1 reveals distinct features that explain its dual permeability. The selectivity filter includes five key residues: H63, I185, G194, R200, and H131. Notably, the arginine R200 adopts an unexpected position where it forms hydrogen bonds with neighboring histidine H63 rather than projecting into the pore as in water-specific aquaporins . The histidine H131 sterically enforces this special position of R200 and interacts with water molecules entering the pore, expanding the conventional four-residue selectivity filter to five residues .

What expression systems are commonly used for recombinant TIP2-1 production?

Recombinant aquaporins including TIP2-1 can be expressed in multiple systems:

  • Yeast expression systems: Saccharomyces cerevisiae is commonly used for functional studies of aquaporins, allowing for both localization studies when tagged with GFP and functional assays such as freeze-thaw survival tests .

  • Xenopus laevis oocytes: This system is particularly useful for detailed characterization of water permeability through swelling assays, as demonstrated with other plant aquaporins .

  • Bacterial expression: E. coli systems can be used for high-yield protein production for structural studies.

What methods are used to verify the functional expression of recombinant TIP2-1?

Several approaches can confirm functional expression:

  • Fluorescence microscopy: When tagged with GFP, proper plasma membrane localization can be confirmed visually .

  • Freeze-thaw survival assays: These quantify water permeability of aquaporins by testing the ability of expressing cells to survive freeze-thaw cycles. Functional water-permeable aquaporins improve survival rates significantly .

  • Swelling assays: When expressed in Xenopus oocytes, water permeability can be measured by placing the oocytes in a hypotonic solution and measuring the rate of swelling .

How do specific mutations in the selectivity filter affect TIP2-1 permeability and selectivity?

The selectivity filter mutations in TIP2-1 can dramatically alter its permeability and selectivity profile. The double mutation I185H × G194C renders TIP2-1 impermeable to ammonia while maintaining water permeability . Molecular dynamics simulations reveal that:

  • The permeability decreases by a factor of 2.5 for water and 4 for ammonia in the double mutant, increasing water selectivity by a factor of 1.6 .

  • The bulky histidine in I185H narrows the pore constriction, reducing the average pore radius from 1.8 to 1.4 Å at z = 8 Å .

  • The H185 orientation allows its aromatic ring to align parallel to the channel axis, providing a new hydrogen bonding site for water molecules deeper in the pore .

  • The G194C mutation stabilizes the position of the H185 side chain through the sulfhydryl group, preventing the histidine ring from flipping and maintaining its interaction with water .

Individual mutations (either I185H or G194C alone) are insufficient to create the same selective effect, demonstrating the cooperative nature of these residues in determining channel selectivity .

What computational methods are most effective for simulating TIP2-1 structure and function?

Based on current research, effective computational approaches include:

  • Molecular dynamics (MD) simulations: Microsecond-long MD simulations using force fields such as CHARMM36 and Amber ff99SB-ILDN have proven valuable for studying TIP2-1. These simulations can:

    • Calculate permeabilities and free energy profiles for water and ammonia along the pore

    • Identify structural determinants of selectivity

    • Capture spontaneous opening and closing of the pore

  • Adaptive biasing methods: The accelerated weight histogram method (AWH) enables calculation of free energies for ammonia by ensuring multiple permeation events through the pore in a stochastic manner .

  • Pore radius calculations: Tracking average pore radius profiles with root-mean-square deviations helps understand how mutations affect the physical dimensions of the channel .

Force FieldAdvantagesLimitations
CHARMM36Better captures effects of double mutation on SF regionMay show disruption of hydrogen bonds in NPA region
Amber ff99SB-ILDNMore stable NPA regionShows weaker effects of mutations on water interactions

How can researchers accurately measure ammonia versus water permeability in TIP2-1?

Distinguishing between ammonia and water permeability requires specialized techniques:

  • Yeast growth assays: Ammonia permeability can be assessed by growth experiments where yeast expressing TIP2-1 is grown on media where ammonia transport is essential for survival. Mutants like I185H × G194C that lose ammonia permeability fail to grow under these conditions .

  • Xenopus oocyte expression systems: These can be used to confirm changes in water permeability independently from ammonia permeability .

  • Free energy calculations: Computational approaches can calculate the free energy barriers for both water and ammonia along the channel, providing quantitative measures of relative permeability .

  • Hydrogen bond network analysis: Tracking water-pore and water-water hydrogen bonds in the selectivity filter region reveals how mutations affect molecular interactions that influence permeability .

What is known about the gating mechanism of TIP2-1 and how can it be investigated experimentally?

Molecular dynamics simulations have revealed spontaneous opening and closing of the TIP2-1 pore on the cytosolic side, suggesting a gating mechanism . To investigate this experimentally:

  • Site-directed mutagenesis: Target residues involved in the observed gating transitions to confirm their role.

  • Crystallography under different conditions: Attempt to capture the channel in both open and closed conformations.

  • Voltage-clamp techniques: When expressed in oocytes, voltage-dependent gating can be assessed using electrophysiological methods.

  • Single-molecule FRET: This could potentially capture conformational changes associated with gating in real-time.

  • Extended MD simulations: Longer timescale simulations (>1 μs) are needed to adequately sample the gating transitions, using enhanced sampling techniques if necessary .

What are the optimal conditions for expressing recombinant Zea mays TIP2-1 in heterologous systems?

For optimal expression in heterologous systems:

  • Codon optimization: The TIP2-1 sequence should be codon-optimized for the expression host (e.g., using tools like IDT DNA tool) .

  • Kozak sequence addition: A host-specific Kozak sequence should be added at the 5' end to enhance translation efficiency .

  • Expression vector selection: For yeast expression, vectors with appropriate promoters such as pSF-TPI1-URA3 can be used .

  • Transformation protocol: For yeast, efficient transformation can be achieved using commercial kits like Frozen-EZ yeast transformation II kit, with selection based on amino acid complementation .

  • Expression verification: Fluorescent tagging (e.g., C-terminal GFP) allows confirmation of proper localization using confocal microscopy .

How should researchers prepare and reconstitute TIP2-1 for functional studies?

A systematic approach for preparation and reconstitution includes:

  • Membrane embedding: The crystal structure of TIP2-1 should be embedded as a tetramer in a lipid bilayer such as POPC, which can be generated using tools like the CHARMM membrane builder .

  • System solvation: The membrane-embedded protein should be solvated in water with appropriate ions (e.g., K+ and Cl-) at physiological concentration (0.15 M) .

  • Histidine protonation: Proper protonation states of histidines are critical. Tools like GROMACS pdb2gmx can predict protonation sites based on hydrogen network analysis .

  • Energy minimization and equilibration protocol:

    • Energy minimization until maximum force < 500 kJ·mol-1·Å-1

    • NVT equilibration with heavy atoms restrained (~500 ps)

    • NPT equilibration with heavy atoms restrained (~10 ns)

    • NPT equilibration with backbone restrained (~20 ns)

    • NPT equilibration with Cα restrained (~60 ns)

    • NPT equilibration without restraints (~200 ns)

  • Configuration sampling: Save configurations every 50 ps for production runs to ensure adequate sampling .

What controls are essential when studying the selectivity of TIP2-1 for different substrates?

When investigating TIP2-1 selectivity, essential controls include:

  • Force field validation: Multiple force fields (e.g., CHARMM36 and Amber ff99SB-ILDN) should be used to validate findings, as they can yield qualitatively similar but quantitatively different results .

  • Negative controls: Non-functional mutants or empty vectors should be included in functional assays to establish baseline measurements .

  • Positive controls: Well-characterized aquaporins with known permeability properties should be included as benchmarks .

  • Reporter gene controls: In yeast-based assays, controls expressing reporter genes like β-glucuronidase can verify assay effectiveness .

  • Non-limiting enzyme activity: When co-expressing enzymes like carbonic anhydrase with aquaporins, enzyme activity should be measured to ensure it's not a limiting factor .

Why might recombinant TIP2-1 show poor membrane localization and how can this be addressed?

Poor membrane localization can result from several factors:

  • Protein misfolding: TIP2-1 is a complex membrane protein that may misfold during heterologous expression. Consider:

    • Lowering expression temperature

    • Co-expressing molecular chaperones

    • Adding stabilizing agents during expression

  • Trafficking issues: Based on observations with other aquaporins like SiPIP2;1, some aquaporins may show poor plasma membrane localization despite expression . Solutions include:

    • Adding trafficking enhancement sequences

    • Co-expressing trafficking-assisting proteins

    • Testing different fusion tag positions or types

  • Expression level variation: Monitor expression levels using western blotting to confirm adequate protein production.

  • Host compatibility: If consistent problems occur, consider alternative expression systems that might better accommodate plant membrane proteins.

How can researchers address force field limitations when simulating TIP2-1?

Molecular dynamics simulations of TIP2-1 face several force field limitations:

  • Force field discrepancies: Different results were observed between CHARMM36 and Amber ff99SB-ILDN force fields, particularly in histidine orientation and hydrogen bonding networks . Recommendations include:

    • Running simulations with multiple force fields

    • Comparing results with experimental data when available

    • Using enhanced sampling techniques to overcome energy barriers

  • NPA region stability issues: Some force fields may lead to disruption of hydrogen bonds in the highly conserved NPA region . To address this:

    • Monitor key hydrogen bonds throughout simulations

    • Exclude data from monomers showing unstable NPA regions

    • Consider force field modifications specifically optimized for aquaporins

  • Parameter validation: Validate force field parameters specifically for substrate molecules (water, ammonia) interacting with key protein residues.

What approaches can resolve data inconsistencies between computational predictions and experimental results for TIP2-1?

When computational and experimental results disagree:

  • Simulation timescale considerations: Ensure simulations run long enough (microseconds) to capture relevant conformational changes and permeation events .

  • Experimental condition matching: Adjust simulation conditions (temperature, pH, membrane composition) to match experimental setups as closely as possible.

  • Multi-scale modeling: Combine atomistic simulations with coarse-grained approaches to bridge timescale gaps.

  • Iterative refinement: Use experimental data to refine computational models, then validate refined models with new experiments.

  • Alternative metrics: Develop and compare multiple analytical approaches for both computational and experimental data, rather than relying on a single metric of permeability or selectivity.

How might the knowledge of TIP2-1 structure-function relationship be applied to engineer aquaporins with novel selectivity profiles?

The insights from TIP2-1 structure-function studies suggest several engineering approaches:

  • Rational design of the selectivity filter: The demonstrated effects of the I185H × G194C double mutation reveal how cooperative mutations can dramatically alter selectivity . This knowledge could be applied to engineer aquaporins with selectivity for specific molecules beyond water and ammonia.

  • Manipulation of pore dimensions: The narrowing effect of bulky residues at key positions could be exploited to create size-selective channels .

  • Hydrogen bonding network engineering: Modifying residues that participate in hydrogen bonding with channel substrates could tune selectivity for molecules with different hydrogen bonding capabilities .

  • Gating control mechanisms: Based on the observed spontaneous gating of TIP2-1, engineering pH or voltage-sensitive residues at key positions might create switchable aquaporins .

  • Hybrid selectivity filters: Combining elements from different aquaporin subtypes might create channels with novel permeability profiles.

What questions remain unresolved about the molecular determinants of substrate selectivity in TIP2-1?

Despite significant advances, several key questions remain:

  • Contribution of non-SF residues: How do residues outside the conventional selectivity filter influence permeability and selectivity?

  • Dynamic conformational effects: What role do protein dynamics and conformational changes play in determining selectivity beyond static structural features?

  • Water-substrate competition: How does competition between water and other substrates like ammonia influence effective permeability in vivo?

  • Species-specific variations: How do structural and functional differences in TIP2-1 between plant species relate to their physiological roles and environmental adaptations?

  • Regulation mechanisms: What cellular signaling pathways and post-translational modifications regulate TIP2-1 activity in response to environmental conditions?

How can high-throughput approaches accelerate TIP2-1 research and aquaporin engineering?

Advancing TIP2-1 research could benefit from:

  • Deep mutational scanning: Systematic creation and characterization of thousands of TIP2-1 variants could comprehensively map sequence-function relationships.

  • Machine learning approaches: Training ML models on aquaporin sequence-function data could predict properties of novel variants and guide engineering efforts.

  • Automated molecular dynamics workflows: Developing pipelines for automated simulation setup, execution, and analysis would enable rapid in silico screening of TIP2-1 variants.

  • Microfluidic permeability assays: High-throughput functional characterization using cell-based microfluidic platforms could accelerate experimental validation.

  • Integrative structural biology: Combining data from X-ray crystallography, cryo-EM, NMR, and computational methods could provide more complete structural models of TIP2-1 in different conformational states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.