Recombinant Zea mays Aquaporin TIP2-2 (TIP2-2)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Recombinant TIP2-2 is expressed in E. coli with an N-terminal His tag for purification and detection. Key features include:

PropertyDetail
Protein LengthFull-length (1–250 amino acids)
UniProt IDQ9ATL8
Gene NameTIP2-2
SynonymsTonoplast intrinsic protein 2-2; ZmTIP2-2; ZmTIP2;2
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Amino Acid SequenceMVKLAFGSVGDSFSVTSIKAYVAEFIATLLFVFAGVGSAIAFGQLTNGGALDPAGLVAIAVAHALALFVGVSVAANTSGGHLNPAVTFGLAVGGHITVLTGLFYWVAQLLGASVACLLLRFVTHGKAIPTHGVSGGTTELEGVVFEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAADFAGNWVYWVGPLIGGGLAGLVYGDVFIGGSYQQVADQDYA

Key Functional Roles

  1. Water Transport: Facilitates water movement across the tonoplast, influencing cell turgor pressure and vacuolar homoeostasis .

  2. Stress Adaptation: Likely involved in drought or osmotic stress responses by modulating water retention .

  3. Developmental Processes: TIPs in other species regulate lateral root emergence and shoot elongation via spatiotemporal water distribution .

Research Applications

  • Functional Studies: Used to investigate tonoplast water permeability and solute selectivity in heterologous systems (e.g., Xenopus oocytes or yeast) .

  • Structural Analysis: His-tag enables purification for crystallization or NMR studies to resolve channel architecture .

  • Agricultural Biotechnology: Potential target for improving drought tolerance in maize by enhancing water conservation .

Comparative Analysis with Related Aquaporins

TIP2-2 belongs to the TIP subfamily, which is distinct from plasma membrane (PIP) and nodulin (NIP) aquaporins. Below is a comparison of TIP2-2 with other TIPs and AQPs:

FeatureTIP2-2 (Zea mays)TIP2;1 (Arabidopsis)PIP2;1 (Arabidopsis)
Subcellular LocalizationTonoplastTonoplastPlasma membrane
Primary FunctionWater/solute transportLateral root emergence CO₂ permeability
Sequence ConservationModerate (evolved in angiosperms) High in angiosperms Highly conserved

Evolutionary and Functional Insights

Phylogenetic studies reveal that TIP2-2 shares ancestry with TIP2;3 in vascular plants, diverging from a common lineage in ferns and gymnosperms . Unlike PIP2;1, which shows high sequence conservation across angiosperms, TIP2-2 exhibits moderate variability, suggesting species-specific adaptations .

Challenges and Future Directions

While TIP2-2’s role in maize remains understudied, its homologs in Arabidopsis highlight its potential in:

  • Mechanistic Studies: Elucidating tonoplast water channels’ gating mechanisms.

  • Translational Research: Engineering TIP2-2 for improved water use efficiency in crops.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form is stable for 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We are open to developing your preferred tag type. Please specify your requirements, and we will prioritize fulfilling them during production.
Synonyms
TIP2-2; Aquaporin TIP2-2; Tonoplast intrinsic protein 2-2; ZmTIP2-2; ZmTIP2;2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
TIP2-2
Target Protein Sequence
MVKLAFGSVGDSFSVTSIKAYVAEFIATLLFVFAGVGSAIAFGQLTNGGALDPAGLVAIAVAHALALFVGVSVAANTSGGHLNPAVTFGLAVGGHITVLTGLFYWVAQLLGASVACLLLRFVTHGKAIPTHGVSGGTTELEGVVFEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAADFAGNWVYWVGPLIGGGLAGLVYGDVFIGGSYQQVADQDYA
Uniprot No.

Target Background

Function
Aquaporins are integral membrane proteins responsible for facilitating the transport of water and small neutral solutes across cell membranes.
Database Links

KEGG: zma:541895

STRING: 4577.GRMZM2G056908_P01

UniGene: Zm.614

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Zea mays Aquaporin TIP2-2 and what is its primary cellular localization?

TIP2-2 (Q9ATL8) is a tonoplast intrinsic protein found primarily in the vacuolar membrane (tonoplast) of maize cells. It belongs to the TIP subfamily of aquaporins, which facilitate water movement across the tonoplast. The full-length protein consists of 250 amino acids and contains characteristic transmembrane domains common to aquaporins . While TIPs are predominantly localized to the tonoplast, studies have shown that some TIPs may exhibit dual localization, being present in both tonoplast and plasma membranes under specific conditions .

How does the expression pattern of TIP2-2 vary across maize tissues and developmental stages?

TIP2-2 shows distinct spatial and temporal expression patterns:

Tissue/Developmental StageExpression LevelNotes
RootsHighParticularly in the elongation zone
LeavesModerateLower than in roots
Developing seedsLowTIP3s are more dominant in seeds
Seedling stageHighIncreases dramatically post-germination

The expression of TIP2-2 is notably higher in root tissues, consistent with its role in water transport. TIP2-2 expression is particularly enriched in meristematic regions and zones of cell enlargement, such as the tips of primary and lateral roots . This expression pattern suggests TIP2-2's involvement in facilitating water movement during cell expansion and growth .

What are the optimal methods for expressing and purifying recombinant TIP2-2 protein?

For successful recombinant TIP2-2 expression and purification:

  • Expression system: E. coli is commonly used for recombinant TIP2-2 expression .

  • Construct design:

    • Include an N-terminal His-tag for purification

    • Use the full-length sequence (1-250 amino acids)

    • Consider codon optimization for E. coli expression

  • Purification protocol:

    • Lyse cells in an appropriate buffer (typically Tris/PBS-based, pH 8.0)

    • Perform affinity chromatography using Ni-NTA resin

    • Include 6% trehalose in the storage buffer to maintain protein stability

    • Store purified protein at -20°C/-80°C with 50% glycerol

  • Quality control:

    • Assess purity via SDS-PAGE (should exceed 90%)

    • Verify protein identity through western blotting or mass spectrometry

    • Test functionality through liposome-based water transport assays

How can researchers effectively localize TIP2-2 in plant tissues?

Several complementary approaches can be used to determine TIP2-2 localization:

  • Fluorescent protein fusion constructs:

    • Generate TIP2-2-GFP fusion proteins under native promoters

    • Transform into maize or model plants like Arabidopsis

    • Visualize using confocal laser scanning microscopy

  • Immunolocalization:

    • Develop specific antibodies against TIP2-2 or use anti-GFP antibodies for fusion proteins

    • Perform western blotting to confirm specificity

    • Use immunocytochemistry with gold-labeled secondary antibodies for electron microscopy

  • Promoter-reporter gene fusions:

    • Clone the TIP2-2 promoter (approximately 1.5 kb upstream)

    • Fuse to reporter genes like GUS (β-glucuronidase)

    • Analyze expression patterns through histochemical staining

What methodological approaches can determine TIP2-2 water transport activity?

To characterize TIP2-2 water transport functionality:

  • Xenopus oocyte expression system:

    • Inject TIP2-2 cRNA into Xenopus oocytes

    • Measure osmotic water permeability by monitoring oocyte swelling in hypotonic solution

    • Use mercuric chloride as an inhibitor to confirm aquaporin-mediated transport

  • Proteoliposome assays:

    • Reconstitute purified TIP2-2 into liposomes

    • Measure water flux using stopped-flow light scattering

    • Calculate permeability coefficients under various conditions

  • In planta functional analysis:

    • Generate TIP2-2 overexpression lines and knockout mutants

    • Compare hydraulic conductivity and osmotic stress responses

    • Measure vacuolar water movement using pressure probe techniques

How do post-translational modifications regulate TIP2-2 activity?

TIP2-2 activity is regulated by several post-translational modifications:

  • Phosphorylation:

    • Serine residues are the most commonly phosphorylated sites in ZmTIPs

    • The most highly conserved phosphorylation site in ZmTIPs is the Ser-residue located in the α-helixes of HE

    • Phosphorylation affects both protein trafficking and channel gating

  • Trafficking regulation:

    • Post-translational modifications influence TIP2-2 movement between cellular compartments

    • Phosphorylation states affect membrane targeting and insertion efficiency

  • Environmental response modulation:

    • Dark adaptation can increase TIP2-2 protein levels, partially through a phytochrome A (phyA)-dependent pathway

    • In Arabidopsis, TIP2-2-GFP expression increases during dark adaptation in wild-type plants but shows reduced increase in phyA mutants

How does TIP2-2 contribute to maize cold tolerance mechanisms?

Recent research has revealed complex relationships between TIP proteins and cold tolerance in maize:

  • Negative regulators of cold tolerance:

    • Overexpressing TIP2;1 (along with TIP3;2 and TIP4;3) reduced cold tolerance in maize seedlings

    • Expression of most TIP genes decreases during cold stress

  • Physiological mechanisms:

    • TIPs modulate water movement across the tonoplast during cold stress

    • They influence reactive oxygen species (ROS) accumulation and stomatal movement

    • TIPs affect the expression of cold-responsive genes, including DREB1 and peroxidase genes

  • Genetic variation:

    • Natural variation in TIP expression levels correlates with cold tolerance differences among maize inbred lines

    • Mutations affecting TIP expression can enhance cold tolerance by modulating water flux and ROS homeostasis

What role does TIP2-2 play in root development and lateral root emergence?

TIP2-2 contributes significantly to root development through several mechanisms:

  • Spatial and temporal expression patterns:

    • TIP2-2 is highly expressed in root tissues, particularly in the elongation zone and root meristems

    • Its expression pattern suggests involvement in cell elongation and root growth processes

  • Root-specific promoter activity:

    • MaTIP2-2 promoters (homologous to ZmTIP2-2) show strong root-specific expression

    • In transgenic banana, MaTIP2-2a promoter directed high levels of gene expression almost exclusively in root tissues

  • Lateral root development:

    • Aquaporins like TIP2-2 facilitate the proper development of lateral roots

    • They enable the spatial and temporal fine-tuning of cellular water transport during lateral root primordium (LRP) morphogenesis and emergence

    • TIPs are critical for maintaining appropriate osmotic conditions during rapid cell expansion in developing lateral roots

How does TIP2-2 function in chloroplast osmoregulation and photosynthesis?

Recent research has identified unexpected roles for TIP family aquaporins in chloroplast function:

  • Chloroplast localization:

    • Some TIP family members, including TIP1;2 and TIP2;1, have been detected in chloroplast membranes

    • TIP2;1 resides primarily in the thylakoid membrane, while TIP1;2 is present in both thylakoid and envelope membranes

  • Photosynthetic regulation:

    • TIP aquaporins facilitate water movement into and within chloroplasts

    • Mutants lacking TIP proteins showed reduced rates of photosynthetic electron transport in leaves

    • Chloroplasts from TIP mutants underwent less volume changes upon osmotic treatment and in light conditions

  • Physiological significance:

    • TIPs contribute to water balance in chloroplasts, which is critical for optimal photosynthesis

    • They play a role in the acidification of the thylakoid lumen, affecting pH-dependent photoprotective mechanisms

    • TIPs help chloroplasts overcome osmotic stress, particularly under fluctuating light conditions

How does TIP2-2 compare structurally and functionally to other aquaporin family members?

Comparative analysis of TIP2-2 with other aquaporins reveals:

  • Structural comparison:

    • TIP2-2 shares the characteristic hourglass-shaped structure of aquaporins with six transmembrane domains

    • The selectivity filter (SF) composition of TIP2;1 (H63, I185, G194, R200) is similar to that of the ammonia-permeable mammalian AQP8

  • Functional differences:

    • Unlike plasma membrane intrinsic proteins (PIPs), which primarily facilitate water movement across the plasma membrane, TIPs mediate water exchange between the vacuole and cytoplasm

    • TIP2-2 can transport both water and small uncharged molecules like ammonia, showing broader substrate specificity than some other aquaporins

  • Expression pattern distinctions:

    • ZmTIP1-2 shows higher expression in root and anthers

    • ZmTIP2s (including TIP2-2) are mainly expressed in roots

    • ZmTIP3s are seed-specific

    • ZmTIP4s are predominantly expressed in leaves

How has TIP2-2 evolved across plant species and what is its phylogenetic relationship to other aquaporins?

The evolutionary history of TIP2-2 reveals important patterns:

  • Phylogenetic relationships:

    • TIP2, TIP3, and TIP4 represent basal subgroups in the aquaporin family

    • TIP1 and TIP5 are sister subgroups to TIP3 and TIP2, respectively

  • Evolutionary conservation:

    • Major expansion of TIP subgroups likely originated in the ancestor of seed plants

    • The number of species containing TIPs increased by 2–3 times from Streptophyte algae to hornworts and maintained over 90% representation in seed plants

  • Functional conservation:

    • The highly evolutionary conservation of TIP1;1, TIP1;2, TIP2;3 and PIP2;1 plays important roles in the flowering process for both monocots and eudicots

    • This suggests fundamental roles in plant water relations that have been preserved through evolution

Can TIP2-2 promoters be used for tissue-specific gene expression in biotechnology applications?

TIP2-2 promoters show promise for biotechnology applications:

  • Root-specific expression:

    • TIP2-2 promoters drive strong root-specific expression in transgenic plants

    • MaTIP2-2a (homologous to ZmTIP2-2) showed average GUS expression levels more than double those of the maize ubiquitin promoter in roots, while maintaining low leaf expression

  • Expression strength variations:

    • Different TIP2-2 promoters can drive varying levels of transgene expression

    • MaTIP2-2a promoter showed very high expression (approximately seven times higher than the ZmUbi promoter)

    • MaTIP2-2b promoter showed very low levels of root expression (averaging just 233 ρmol 4-MU min⁻¹ mg⁻¹ TSP)

  • Applications in genetic engineering:

    • TIP2-2 promoters can be used to drive either very high or very low levels of transgene expression specifically in roots

    • This specificity is valuable for engineering traits like drought tolerance, nutrient uptake efficiency, or resistance to root pathogens without affecting other plant tissues

What are the remaining knowledge gaps in understanding TIP2-2 function and regulation?

Despite significant advances, several knowledge gaps remain:

  • Precise regulatory mechanisms:

    • How environmental signals are integrated into TIP2-2 expression and activity regulation

    • The complete signaling pathways controlling TIP2-2 trafficking and gating

  • Interacting partners:

    • Identification of proteins that interact with TIP2-2 to modulate its function

    • The role of TIP2-2 in multiprotein complexes within the tonoplast

  • Substrate specificity:

    • Comprehensive characterization of all possible substrates beyond water and ammonia

    • Structural determinants governing substrate selectivity differences among TIP subfamilies

How might TIP2-2 research contribute to crop improvement for climate resilience?

TIP2-2 research could advance climate-resilient crop development:

  • Cold stress adaptation:

    • Modulating TIP expression could enhance cold tolerance in maize varieties

    • Natural variation in TIP genes provides genetic resources for breeding cold-tolerant maize varieties

  • Drought tolerance enhancement:

    • TIP mutants have shown increased drought tolerance without compromising yield-related traits

    • This provides potential genetic resources for developing maize varieties with both cold and drought tolerance

  • CO₂ response optimization:

    • Recent studies indicate TIP proteins are associated with plant responses to elevated CO₂

    • Understanding TIP2-2's role in CO₂ responses could help develop crops adapted to future atmospheric conditions

Understanding TIP2-2 function and regulation will be increasingly important as climate change presents more extreme and variable growing conditions for important crops like maize.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.