Recombinant Zea mays Aquaporin TIP2-3 (TIP2-3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. We recommend contacting your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of that tag.
Synonyms
TIP2-3; POR2; Aquaporin TIP2-3; Tonoplast intrinsic protein 2-3; ZmTIP2-3; ZmTIP2;3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
TIP2-3
Target Protein Sequence
MVKLAFGSFRDSLSAASLKAYVAEFIATLLFVFAGVGSAIAYSQLTKGGALDPAGLVAIAIAHAFALFVGVSMAANISGGHLNPAVTFGLAVGGHITILTGILYWVAQLLGASVACFLLQYVTHGQAIPTHGVSGISEIEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPMAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLVGGGLAGLVYGDVFIASYQPVGQQEYP
Uniprot No.

Target Background

Function
Water channel required to facilitate the transport of water across cell membrane.
Database Links

KEGG: zma:541687

STRING: 4577.GRMZM2G125023_P01

UniGene: Zm.615

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in roots.

Q&A

What is the basic structure of ZmTIP2;3 and how does it compare to other aquaporins?

ZmTIP2;3 belongs to the tonoplast intrinsic protein family of aquaporins in maize. The protein exhibits a tetrameric structure typical of aquaporin family members, with each monomer containing a hydrophobic pore that facilitates passive solute transfer. ZmTIP2;3 contains two highly conserved NPA (Asn-Pro-Ala) motifs which are critical for water selectivity and transport function . Within the TIP2 subfamily, ZmTIP2;3 shares close evolutionary relationships with ZmTIP1;1, ZmTIP2;1, and ZmTIP2;2, suggesting functional similarities in water transport capabilities and stress response mechanisms .

What are the gene identifiers and nomenclature associated with ZmTIP2;3?

The ZmTIP2;3 gene is identified by multiple designations in biological databases. Its primary gene names include TIP2-3, por2, and the genomic identifier GRMZM2G125023 . This aquaporin is also commonly referred to as "aquaporin TIP2-3" in scientific literature. When designing primers or ordering commercial antibodies, researchers should be aware of these multiple identifiers to ensure accurate targeting of the specific gene or protein . The genomic location and sequence information can be accessed through maize genome databases using these identifiers.

How is ZmTIP2;3 classified within the broader aquaporin family in maize?

Comprehensive phylogenetic analysis of aquaporins in Zea mays has revealed that ZmTIP2;3 belongs to the Tonoplast Intrinsic Protein (TIP) subfamily, which is one of four distinct aquaporin subfamilies in maize (alongside PIPs, NIPs, and SIPs). Among the 41 identified ZmAQPs proteins in the maize genome, 15 belong to the TIP subfamily . The TIP family members are predominantly localized to the tonoplast (vacuolar membrane) and play crucial roles in maintaining cell morphology and osmotic pressure homeostasis. ZmTIP2;3 specifically belongs to the TIP2 subgroup, which has been widely implicated in water transport functions and stress response mechanisms across various plant species .

What is known about the expression pattern of ZmTIP2;3 during plant development?

ZmTIP2;3 exhibits distinct spatiotemporal and tissue-specific expression patterns throughout maize development. Research has shown that aquaporins in maize, including ZmTIP2;3, display highly regulated expression profiles during seed germination and early seedling development . Specifically, ZmTIP2;3 expression is significantly induced in maize roots during arbuscular mycorrhizal fungi symbiosis, suggesting its specialized role in this mutualistic relationship . This expression pattern differs from other TIP family members, highlighting the functional specialization within this gene family. Researchers investigating ZmTIP2;3 should consider these tissue-specific and developmental stage-dependent expression patterns when designing experiments .

How does drought stress affect ZmTIP2;3 expression and function?

Under drought stress conditions, ZmTIP2;3 expression is significantly upregulated, particularly in plants that have established symbiotic relationships with arbuscular mycorrhizal fungi . This enhanced expression correlates with improved drought tolerance, suggesting that ZmTIP2;3 plays a critical role in water homeostasis during water-limited conditions. Functional studies using zmtip2;3 mutants have demonstrated that the absence of this aquaporin results in decreased relative water content in leaves under drought stress, confirming its direct involvement in water transport and conservation mechanisms . This regulatory response appears to be part of a coordinated stress adaptation strategy that involves multiple drought-responsive genes.

What methodologies are most effective for studying ZmTIP2;3 expression?

For accurate quantification of ZmTIP2;3 expression, qRT-PCR using reference genes such as ACTIN 1 is recommended . When designing primers, researchers should target unique regions of the ZmTIP2;3 sequence to avoid cross-amplification with other closely related TIP family members. For protein-level studies, western blotting using specific antibodies against ZmTIP2;3 can be employed . Commercial antibodies are available with high specificity for ZmTIP2;3 (anti-Zea mays TIP2-3 polyclonal antibodies) . For subcellular localization studies, fluorescent protein fusions combined with confocal microscopy provide valuable insights into the tonoplast localization of ZmTIP2;3 and its potential redistribution under stress conditions.

What physiological parameters are affected by ZmTIP2;3 during drought stress?

Studies comparing wild-type maize plants with zmtip2;3 mutants have revealed several key physiological parameters influenced by this aquaporin during drought stress. The presence of functional ZmTIP2;3 correlates with higher relative water content (RWC) in leaves, enhanced photosynthetic efficiency, increased activities of antioxidant enzymes (POD and SOD), and higher proline content . In zmtip2;3 mutants under drought stress, the relative water content was reduced by approximately 25.8% compared to wild-type plants when in symbiosis with AMF, demonstrating the critical role of this aquaporin in maintaining cellular water balance . These findings indicate that ZmTIP2;3 not only facilitates water transport but also contributes to the activation of multiple drought adaptation mechanisms.

How does ZmTIP2;3 interact with other drought-responsive genes?

ZmTIP2;3 functions within a complex network of drought-responsive genes. qRT-PCR analyses have shown that the expression levels of several key stress-related genes, including LEA3, P5CS4, and NECD1, are significantly reduced in zmtip2;3 mutants compared to wild-type plants under drought conditions . LEA3 encodes a late embryogenesis abundant protein involved in cellular protection, P5CS4 is essential for proline biosynthesis (an important osmoprotectant), and NECD1 is involved in abscisic acid (ABA) biosynthesis, a critical drought-responsive hormone . These findings suggest that ZmTIP2;3 may function upstream of these stress-responsive pathways or act synergistically within a coordinated drought response network.

What experimental approaches can effectively measure ZmTIP2;3-mediated water transport?

Several experimental approaches can be employed to quantify ZmTIP2;3-mediated water transport. For whole-plant studies, gravimetric water loss measurements, pressure chamber techniques for water potential determination, and infrared thermography for leaf temperature assessment provide valuable data . At the cellular level, protoplast swelling assays and cell pressure probe techniques can directly measure water permeability. For molecular-level characterization, heterologous expression of ZmTIP2;3 in Xenopus oocytes followed by osmotic swelling assays represents the gold standard for quantifying water channel activity. Additionally, comparing relative water content and physiological parameters between wild-type and zmtip2;3 mutant plants under controlled drought conditions provides functional evidence of ZmTIP2;3's role in water transport .

How does arbuscular mycorrhizal fungi symbiosis influence ZmTIP2;3 expression?

Arbuscular mycorrhizal fungi (AMF) symbiosis significantly induces ZmTIP2;3 gene expression in maize roots . This upregulation appears to be specific to the symbiotic relationship and is further enhanced under drought stress conditions. The molecular mechanisms underlying this induction likely involve symbiosis-specific signaling pathways. Researchers examining this relationship should employ proper experimental controls, including non-inoculated plants and plants grown under various moisture conditions, to accurately assess the AMF-specific effects on ZmTIP2;3 expression . Time-course experiments are also valuable for understanding the temporal dynamics of ZmTIP2;3 induction during the establishment and maintenance of the symbiotic relationship.

What is the functional significance of ZmTIP2;3 in mycorrhizal symbiosis under drought?

ZmTIP2;3 plays a crucial role in enhancing drought tolerance during mycorrhizal symbiosis. Comparative studies between wild-type and zmtip2;3 mutant maize plants have demonstrated that the absence of functional ZmTIP2;3 results in reduced mycorrhizal colonization rates under drought stress . This finding suggests that ZmTIP2;3 may facilitate water and nutrient exchange at the plant-fungus interface. Furthermore, symbiotic zmtip2;3 mutants exhibit lower biomass accumulation and reduced drought tolerance compared to symbiotic wild-type plants, indicating that ZmTIP2;3 is essential for realizing the full benefits of mycorrhizal symbiosis under water-limited conditions .

What methodological approaches can assess ZmTIP2;3's role in mycorrhizal water dynamics?

To investigate ZmTIP2;3's role in mycorrhizal water dynamics, researchers can employ several complementary approaches. Root hydraulic conductivity measurements using a high-pressure flow meter can quantify water movement through mycorrhizal and non-mycorrhizal roots . Microscopic techniques, including transmission electron microscopy and immunogold labeling with ZmTIP2;3-specific antibodies, can visualize the localization of this aquaporin at the plant-fungus interface. Stable isotope tracing using deuterium or 18O can track water movement from fungal hyphae to plant roots. Additionally, comparative physiological studies between wild-type and zmtip2;3 mutant plants under varied irrigation and mycorrhizal inoculation treatments provide valuable functional insights . These approaches should be combined with molecular analyses of gene expression and protein abundance for comprehensive characterization.

What recombinant protein systems are available for ZmTIP2;3 research?

Several recombinant protein expression systems are available for ZmTIP2;3 research. Commercial sources offer recombinant Zea mays Aquaporin TIP2-3 proteins expressed in cell-free systems with ≥85% purity as determined by SDS-PAGE . Additionally, E. coli, yeast, baculovirus, and mammalian cell expression systems can be employed for recombinant ZmTIP2;3 production . Each system offers distinct advantages: E. coli provides high yield but may have limitations for proper folding of membrane proteins; yeast systems offer post-translational modifications; baculovirus systems provide higher eukaryotic processing; and mammalian cell systems offer the most native-like modifications. Researchers should select the expression system based on their specific experimental requirements, such as protein yield, functional activity, or structural studies.

What antibody resources are available for ZmTIP2;3 detection and localization?

Commercially available antibody resources for ZmTIP2;3 research include rabbit anti-Zea mays TIP2-3 polyclonal antibodies . These antibodies are suitable for various applications, including ELISA and Western blot analyses. When selecting antibodies, researchers should consider specificity against other TIP family members, as sequence similarity might lead to cross-reactivity. For immunolocalization studies, these antibodies can be used for both light and electron microscopy approaches. Custom antibody production targeting specific epitopes of ZmTIP2;3 may be necessary for certain applications . Proper validation of antibody specificity, including the use of zmtip2;3 mutant tissues as negative controls, is essential for reliable results.

How can CRISPR/Cas9 technology be applied to study ZmTIP2;3 function?

CRISPR/Cas9 technology offers powerful approaches for functional characterization of ZmTIP2;3. Knockout mutants can be generated by targeting coding regions, preferably early exons, to ensure complete loss of function . For more nuanced studies, precise modifications can be introduced to alter specific functional domains, such as the NPA motifs essential for water selectivity. Promoter editing can also be employed to modify expression patterns without affecting protein structure. When designing guide RNAs, researchers should ensure specificity to avoid off-target effects on other TIP family members . Phenotypic characterization of edited plants should include water relation parameters, drought response metrics, and mycorrhizal colonization assessments under various environmental conditions to comprehensively understand ZmTIP2;3 function.

How might ZmTIP2;3 be utilized in agricultural biotechnology for drought tolerance?

ZmTIP2;3 presents significant potential for enhancing drought tolerance in agricultural crops through various biotechnological approaches. Overexpression strategies using either constitutive or stress-inducible promoters could enhance water transport efficiency under drought conditions . Alternative approaches include targeted expression in specific tissues most critical for water uptake and conservation. When designing such modifications, researchers should consider potential unintended consequences on plant development, as altered water homeostasis might affect numerous physiological processes. Additionally, co-expression with mycorrhizal-responsive genes might synergistically enhance drought tolerance by promoting both water transport efficiency and symbiotic relationships . Field trials under varied environmental conditions are essential to validate laboratory findings and assess the stability and effectiveness of ZmTIP2;3 modifications across diverse growing conditions.

What are the current technical challenges in ZmTIP2;3 structural biology research?

Structural biology research on ZmTIP2;3 faces several technical challenges common to membrane proteins. X-ray crystallography requires stable, pure protein in sufficient quantities, which is difficult to achieve with membrane proteins like aquaporins . Detergent selection for solubilization while maintaining native conformation is critical yet challenging. Cryo-electron microscopy offers an alternative approach but still requires highly pure, homogeneous samples. Computational approaches, including homology modeling based on known aquaporin structures, can provide initial structural insights while experimental methods are being optimized . Recent advances in membrane mimetics, such as nanodiscs and lipid cubic phase crystallization, may help overcome some of these challenges. Researchers should consider collaborative approaches with structural biology specialists when pursuing these technically demanding studies.

How can systems biology approaches advance our understanding of ZmTIP2;3 in drought response networks?

Systems biology approaches offer powerful tools for understanding ZmTIP2;3's role within broader drought response networks. Multi-omics integration, combining transcriptomics, proteomics, metabolomics, and phenomics data from wild-type and zmtip2;3 mutant plants under various environmental conditions, can reveal the comprehensive impact of this aquaporin . Network analysis can identify co-regulated genes and potential regulatory factors controlling ZmTIP2;3 expression. Genome-wide association studies (GWAS) can identify natural variation in ZmTIP2;3 and correlate specific alleles with drought tolerance phenotypes . Mathematical modeling of water transport processes incorporating ZmTIP2;3 activity parameters can predict whole-plant responses to water limitation. These integrative approaches require interdisciplinary collaboration and sophisticated computational tools but offer unprecedented insights into the complex role of ZmTIP2;3 in drought adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.