Recombinant Zea mays ATP synthase protein MI25

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Zea mays ATP Synthase Protein MI25

Recombinant Zea mays ATP synthase protein MI25 is a bioengineered version of a subunit of the F-type ATP synthase complex in maize. Produced via heterologous expression in E. coli, this His-tagged protein (1–219 amino acids) facilitates studies on ATP synthesis, mitochondrial bioenergetics, and plant stress responses. Its recombinant nature allows controlled production for enzymatic assays, structural studies, and functional analyses in vitro .

Functional Roles in ATP Synthesis

ATP synthase (Complex V) catalyzes ATP production via proton motive force (PMF) in mitochondria. In plants, MI25 likely participates in:

  • Proton Translocation: Facilitating H⁺ flow through the F₀ subunit to drive ATP synthesis in the F₁ sector .

  • Reverse Activity Regulation: Inhibiting ATP hydrolysis under energy stress, as observed in mitochondrial diseases .

  • Cristae Morphology: Contributing to inner mitochondrial membrane bending, enhancing ATP synthesis efficiency .

While direct functional data for Zea mays MI25 is limited, its homology to mitochondrial ATP synthase subunits (e.g., subunit c isoforms in humans) suggests conserved roles in proton-driven ATP production .

Research Applications and Experimental Uses

This recombinant protein supports diverse experimental workflows:

ApplicationMethodology
Enzyme KineticsATP synthesis/hydrolysis assays with coupled proton gradient systems .
Structural StudiesCrystallization or cryo-EM to resolve subunit interactions in plant ATP synthase.
Protein InteractionsCo-IP or pull-down assays to identify binding partners (e.g., cyclophilin D) .
Stress Response ModelsStudying ATP synthase regulation under abiotic stress (drought, salinity).

Example workflow: Inhibiting reverse ATP hydrolysis with epicatechin analogs to restore ATP levels in mitochondrial dysfunction models .

Comparative Analysis with Related Proteins

The Zea mays MI25 shares structural and functional parallels with ATP synthase subunits in other organisms:

Organism/ProteinKey Differences
Triticum aestivum MI25Shorter length (1–192 aa vs. 1–219 aa), identical mature peptide post-cleavage .
Human ATP synthase subunit cIsoforms (P1/P2/P3) with distinct mitochondrial targeting peptides .
Bacterial ATP synthaseSimpler peripheral stalk, reduced regulatory complexity .

These comparisons highlight evolutionary adaptations in plant ATP synthase subunits for specialized metabolic demands.

Challenges and Future Directions

Current limitations include:

  • Lack of Plant-Specific Data: Most studies focus on mammalian or bacterial systems; maize-specific pathways remain underexplored.

  • Functional Redundancy: Potential overlap with other ATP synthase subunits complicates targeted inhibition/activation studies .

Future research should prioritize:

  1. Crystallization Studies: Resolving MI25’s 3D structure to map interaction sites.

  2. Gene Editing Approaches: CRISPR/Cas9-mediated knockouts in maize to validate in vivo roles.

  3. Omics Integration: Metabolomic profiling of ATP synthase-deficient mutants to identify downstream targets.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the order method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, with associated additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
ATP synthase protein MI25; ORF 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MRFSGMDMKGINMLFAAIPSICASSPKKISIYNEEMIVARCFIGFLILSWKSLGKTFKET LDGRIESIQESLQQFFNPNEVILEESNEQQRLLNLWISLRICSTVKVVESLPAARCAPKC EKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERLVSGSTTLVEASTVE QIREAFLLEPRDLIREGFIVLRKVRVGGIPGTCGDGVGL
Uniprot No.

Target Background

Function

This protein represents one of the chains of the nonenzymatic component (CF0 subunit) of the mitochondrial ATPase complex.

Protein Families
ATPase protein MI25 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and key domains of Zea mays ATP synthase protein MI25?

The Zea mays ATP synthase protein MI25 consists of 219 amino acids with a complete sequence of: MRFSGMDMKGINMLFAAIPSICASSPKKISIYNEEEMIVARCFIGFLILSWKSLGKTFKETLDGRIESIQESLQQFFNPNEVILEESNEQQRLLNLWISLRICSTVKVVESLPAARCAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERLVSGSTTLVEASTVEEQIREAFLLEPRDLIREGFIVLRKVRVGGIPGTCGDGVGL . The protein features transmembrane regions that anchor it to the mitochondrial membrane, cytoplasmic domains that interact with other components of the ATP synthase complex, and possibly signal peptide regions that direct its localization within the cell . These structural features are characteristic of the ATP synthase protein MI25-related family and are crucial for the protein's function in ATP synthesis and cellular respiration .

How does Recombinant Zea mays ATP synthase protein MI25 compare to ATP synthase components in other plant species?

Recombinant Zea mays ATP synthase protein MI25 shares functional similarities with ATP synthase components in other plant species, such as Arabidopsis thaliana, though there are species-specific variations in structure and regulation. Research with Arabidopsis has revealed that mitochondrial ATP synthase subunits like OSCP (oligomycin sensitivity-conferring protein) and gamma subunit play essential roles in plant development and energy metabolism . When expression of these subunits is reduced in Arabidopsis, plants exhibit seedling lethality during germination in light conditions, stunting of dark-grown seedlings, and distinctive morphological features such as downward curling or wavy-edged leaf margins . This suggests that while the specific proteins may differ between species, the functional importance of ATP synthase components in plant development and metabolism is conserved across different plant species, with disturbances in their expression potentially leading to widespread phenotypic effects due to altered cellular redox states .

What are the optimal storage conditions for maintaining the stability of Recombinant Zea mays ATP synthase protein MI25?

The optimal storage conditions for Recombinant Zea mays ATP synthase protein MI25 require careful temperature management to maintain protein stability and function. For long-term storage, the protein should be kept at -20°C, with extended storage preferably at -20°C or -80°C to minimize degradation . The protein is typically stored in a Tris-based buffer with 50% glycerol, which has been optimized specifically for this protein to enhance stability . For routine laboratory work, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise protein integrity . Additionally, when handling the protein, researchers should avoid repeated freezing and thawing as this can lead to protein denaturation, aggregation, and loss of enzymatic activity, potentially affecting experimental outcomes . These storage recommendations are designed to preserve the structural integrity and functional properties of the recombinant protein for reliable experimental results.

What methodological approaches can be used to determine the activity of recombinant ATP synthase protein MI25 in vitro?

The activity of recombinant ATP synthase protein MI25 in vitro can be assessed through several complementary methodological approaches. A primary method is the ATP synthesis assay, which measures the protein's ability to catalyze ATP formation from ADP and inorganic phosphate in the presence of a proton gradient. This assay typically employs luminescence-based detection systems that quantify ATP production through luciferase activity, allowing for sensitive and real-time monitoring of enzymatic activity . Additionally, proton pumping assays using pH-sensitive fluorescent dyes can be utilized to assess the protein's ability to translocate H+ ions across membranes, which is crucial for ATP synthesis . Structural integrity and proper assembly of the protein can be analyzed through native gel electrophoresis followed by in-gel activity staining, which preserves protein-protein interactions essential for ATP synthase function . For more detailed functional analysis, researchers may employ oxygen consumption measurements using respirometry techniques, as ATP synthesis is coupled to electron transport chain activity in mitochondria . These approaches, often used in combination, provide comprehensive insights into the functional characteristics of recombinant ATP synthase protein MI25.

What are the critical quality control parameters to verify the integrity and purity of recombinant Zea mays ATP synthase protein MI25 preparations?

To ensure the integrity and purity of recombinant Zea mays ATP synthase protein MI25 preparations, researchers should implement a multi-parameter quality control strategy. SDS-PAGE analysis is essential for verifying the molecular weight (corresponding to the 219 amino acid sequence) and assessing initial purity, while Western blotting with specific antibodies confirms the protein's identity . Mass spectrometry should be employed for precise molecular weight determination and sequence verification, particularly to confirm the presence of all expected post-translational modifications that might affect function . Circular dichroism spectroscopy is valuable for evaluating secondary structure integrity, especially the alpha-helical content which is critical for protein function . Functional integrity can be assessed through ATP synthesis activity assays using reconstituted proteoliposomes or membrane preparations, which measure the protein's ability to catalyze ATP formation under controlled conditions . Additionally, size-exclusion chromatography helps determine whether the protein exists in its native oligomeric state or forms aggregates that could compromise activity . These quality control parameters collectively ensure that the recombinant protein maintains its structural and functional characteristics for reliable experimental applications.

How can RNA editing analysis be applied to study the functional impact of sequence variations in ATP synthase proteins?

RNA editing analysis represents a sophisticated approach to understanding how post-transcriptional modifications affect ATP synthase protein structure and function. Researchers can implement this methodology by first isolating mitochondrial RNA from plant tissues under different conditions (such as control versus stress conditions) and performing deep sequencing to identify editing sites with high precision . Computational tools like CLC Genomic Workbench can then be used to analyze editing patterns, comparing edited transcripts with genomic sequences to identify C-to-U or other editing events that alter the coding sequence . The tertiary structural impact of these edits can be evaluated through protein modeling software, which reveals how amino acid substitutions resulting from RNA editing affect protein conformation, as demonstrated in studies showing that polar edits in the N-terminus of ATP synthase subunits enhance H+ ion selectivity . Functional validation of these structural predictions can be performed through in vitro reconstitution experiments, where wild-type and edited protein variants are compared for ATP synthesis efficiency, proton translocation rates, and complex stability . This comprehensive analytical approach reveals how seemingly minor RNA editing events can significantly impact ATP synthase function by introducing new structural features, such as coiled-coil alpha-helical structures that enhance complex stability, particularly under stress conditions .

What experimental strategies can be employed to investigate the protein-protein interactions between ATP synthase protein MI25 and other components of the ATP synthase complex?

Investigating protein-protein interactions between ATP synthase protein MI25 and other components of the ATP synthase complex requires sophisticated experimental strategies that preserve native interactions while providing high-resolution data. Co-immunoprecipitation (Co-IP) coupled with mass spectrometry represents a foundational approach, where antibodies specific to MI25 can capture the protein along with its interaction partners, followed by identification through LC-MS/MS analysis . For in vivo interaction studies, bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) techniques can be employed, where MI25 and potential interaction partners are tagged with complementary fluorescent protein fragments or fluorophore pairs, respectively, allowing visualization of interactions within living plant cells . Structural details of these interactions can be elucidated through cryo-electron microscopy, which has successfully revealed different conformational states of mitochondrial ATP synthase complexes, showing how components like the b subunit interact with other subunits such as the oligomycin sensitivity-conferring protein (OSCP) . Complementary to these approaches, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction interfaces by identifying regions of altered solvent accessibility upon complex formation . These methodologies, when used in combination, provide comprehensive insights into how ATP synthase protein MI25 integrates within the larger ATP synthase complex to facilitate energy production in plant mitochondria.

What are the current methodological approaches for studying the impact of environmental stressors on ATP synthase protein MI25 function?

Current methodological approaches for studying the impact of environmental stressors on ATP synthase protein MI25 function combine molecular, biochemical, and physiological techniques to provide comprehensive insights. Researchers can employ inducible antisense or RNAi systems, similar to those used with Arabidopsis ATP synthase subunits, where expression of MI25 can be conditionally suppressed under different environmental conditions to assess phenotypic consequences and cellular responses . Proteomics analysis using techniques like 2D-DIGE (two-dimensional difference gel electrophoresis) or iTRAQ (isobaric tags for relative and absolute quantitation) can identify changes in protein abundance, post-translational modifications, and interaction networks when plants are exposed to stressors such as drought, salinity, or temperature extremes . Functional assessment of ATP synthase activity under stress conditions can be performed through oxygen consumption measurements and ATP synthesis assays in isolated mitochondria from stressed plants, providing direct evidence of altered energy metabolism . Complementing these approaches, transcriptome analysis via RNA-Seq can reveal how stress-induced changes in MI25 expression correlate with broader transcriptional reprogramming, particularly focusing on genes involved in energy metabolism, redox homeostasis, and stress response pathways . These integrated methodological approaches collectively illuminate how environmental stressors impact ATP synthase protein MI25 function and the consequent effects on plant energy metabolism and physiological adaptation.

What are the main technical challenges in expressing and purifying functional recombinant Zea mays ATP synthase protein MI25?

Expressing and purifying functional recombinant Zea mays ATP synthase protein MI25 presents several technical challenges that researchers must address to obtain biologically active protein. The hydrophobic nature of the protein, which contains transmembrane regions, poses solubility issues during expression and extraction, often requiring specialized detergents or amphipathic compounds to maintain proper folding and prevent aggregation . Heterologous expression systems may lack plant-specific post-translational modifications or chaperones necessary for proper folding, potentially leading to misfolded or inactive protein, which necessitates careful selection of expression hosts or co-expression with plant-specific folding factors . The protein's integration into the multi-subunit ATP synthase complex in its native environment means that expressing it in isolation may result in structural conformations that differ from its native state, affecting functional assays and interaction studies . Additionally, the presence of mitochondrial targeting sequences can complicate expression in non-plant systems, requiring strategic construct design to either include or remove these sequences depending on the research objectives . To overcome these challenges, researchers often need to optimize multiple variables simultaneously, including expression temperature, induction conditions, solubilization methods, and purification strategies, to balance protein yield with functional integrity for downstream applications.

How can advanced structural biology techniques be applied to elucidate the conformational dynamics of ATP synthase protein MI25?

Advanced structural biology techniques offer powerful approaches to elucidate the conformational dynamics of ATP synthase protein MI25, providing insights beyond static structural information. Cryo-electron microscopy (cryo-EM) represents a revolutionary technique for capturing different conformational states of the ATP synthase complex, as demonstrated in studies of mitochondrial ATP synthase from Pichia angusta that revealed distinct structural arrangements reflecting differences in the central stalk and F1-catalytic domain during the catalytic cycle . This technique can potentially visualize how MI25 changes conformation during ATP synthesis and how these changes coordinate with other subunits of the complex. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides complementary information by measuring the rate of hydrogen-deuterium exchange in different protein regions, revealing dynamic segments and potentially identifying regions involved in conformational changes during catalysis . Nuclear magnetic resonance (NMR) spectroscopy, particularly for specific domains of MI25, can characterize protein dynamics at atomic resolution, capturing transient interactions and conformational fluctuations that occur on different timescales. Additionally, molecular dynamics simulations based on experimentally determined structures can model how RNA editing-induced amino acid changes, such as the polar edits (S20F, S24L, and S30L) in the N-terminus, affect the protein's dynamic behavior, potentially explaining observed functional differences in proton selectivity and complex stability . These advanced techniques, when integrated, provide a comprehensive view of ATP synthase protein MI25's conformational landscape during its functional cycle.

What comparative analyses can reveal about the evolutionary conservation and divergence of ATP synthase protein MI25 across plant species?

Comparative analyses of ATP synthase protein MI25 across plant species can reveal crucial insights into its evolutionary history and functional significance through multiple analytical approaches. Sequence-based phylogenetic analysis comparing MI25 homologs across diverse plant lineages can identify conserved domains that have remained unchanged through evolutionary time, suggesting essential functional regions, as well as divergent regions that may reflect species-specific adaptations or functional innovations . Structural comparative analysis using protein modeling tools can map these sequence variations onto three-dimensional structures, revealing how evolutionary changes might affect protein folding, subunit interactions, or catalytic functions, similar to the analysis performed for ATP synthase b subunit structures that identified unique structural features in different conformational states . Functional comparative genomics examining the effects of MI25 manipulation across different plant species can determine whether the phenotypic consequences observed in model systems (such as the seedling lethality and morphological alterations seen in Arabidopsis with reduced ATP synthase subunit expression) are conserved across diverse plant lineages, indicating shared functional roles . Analysis of RNA editing patterns of MI25 transcripts across species can provide insights into how this post-transcriptional regulatory mechanism has evolved, particularly in response to environmental adaptations, as demonstrated by studies showing specific editing events that affect protein structure and function . These comparative approaches collectively illuminate how evolutionary pressures have shaped ATP synthase protein MI25 structure and function across plant species, potentially identifying innovative targets for crop improvement based on natural variations that enhance energy efficiency or stress tolerance.

How does ATP synthase protein MI25 function correlate with broader patterns of cellular energy metabolism in response to developmental and environmental signals?

ATP synthase protein MI25 function correlates with broader patterns of cellular energy metabolism through complex regulatory networks that respond dynamically to developmental and environmental signals. Research in Arabidopsis has demonstrated that altered expression of ATP synthase subunits affects transcript levels of transcription factors like TCP3 and TCP4, which control leaf development, suggesting that energy sensing through ATP synthase activity influences developmental programming through specific transcriptional cascades . The differential effects on ATP levels observed in light versus dark conditions and in the presence or absence of exogenous carbon sources indicate that MI25 and related ATP synthase components participate in adjusting energy metabolism according to photosynthetic activity and carbon availability, highlighting the integration of mitochondrial function with chloroplast activity and carbon utilization pathways . At the subcellular level, studies have shown that reduced ATP synthase function correlates with increased expression of dynamin-related proteins associated with mitochondrial division, suggesting a feedback mechanism where compromised energy production triggers organelle proliferation to maintain cellular ATP homeostasis . The structural modifications of ATP synthase subunits resulting from RNA editing, particularly under stress conditions, represent another layer of regulation where post-transcriptional modifications fine-tune protein function according to cellular energy demands, as observed in studies showing specific editing events that enhance complex stability during stress . These multi-level correlations between ATP synthase protein MI25 function and broader cellular processes illustrate how plants integrate energy metabolism with developmental programs and environmental responses, enabling adaptive plasticity in changing conditions.

What statistical approaches are most appropriate for analyzing complex datasets from ATP synthase protein MI25 experiments?

Analyzing complex datasets from ATP synthase protein MI25 experiments requires sophisticated statistical approaches tailored to the specific data types and experimental designs. For differential expression analysis of MI25 and related genes across experimental conditions, linear models with empirical Bayes methods (as implemented in tools like limma) provide robust estimates of expression changes while controlling for multiple testing, which is essential when examining transcriptional responses to altered ATP synthase function . When analyzing protein-protein interaction data from co-immunoprecipitation or crosslinking mass spectrometry experiments, statistical significance can be evaluated using specialized scoring systems that consider peptide coverage, spectral counts, and enrichment ratios relative to controls, identifying high-confidence interaction partners of MI25 within the ATP synthase complex . For structure-function correlation studies, multiple regression analyses can quantify relationships between specific structural features (such as RNA editing-induced amino acid changes) and functional parameters (such as ATP synthesis rates or complex stability), helping to identify which structural elements most significantly impact protein function . Time-series experiments examining dynamic responses to environmental stressors benefit from longitudinal data analysis methods, including mixed-effects models that account for within-sample correlations over time and identify significant temporal patterns in ATP synthase activity or expression . Additionally, multivariate statistical approaches such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can uncover patterns in high-dimensional datasets, revealing how MI25 function coordinates with broader metabolic networks across different experimental conditions . These statistical frameworks, when appropriately applied, enhance the extraction of meaningful biological insights from complex experimental data on ATP synthase protein MI25.

How can researchers effectively interpret contradictory data regarding ATP synthase protein MI25 function across different experimental systems?

Effectively interpreting contradictory data regarding ATP synthase protein MI25 function across different experimental systems requires a systematic analytical framework that accounts for methodological variations and biological context. Researchers should first conduct a detailed methodological comparison to identify differences in experimental procedures that might explain divergent results, such as variations in protein expression systems, purification methods, or activity assay conditions, which can significantly impact observed functional properties . Consideration of the biological context is equally important, as ATP synthase activity is highly regulated by cellular conditions; for example, studies in Arabidopsis revealed opposite effects on ATP levels depending on light conditions and carbon source availability, indicating that seemingly contradictory results may reflect biologically relevant regulatory mechanisms rather than experimental artifacts . Meta-analysis techniques can be employed to systematically compare results across multiple studies, identifying consistent patterns amid apparent contradictions and potentially revealing condition-specific effects that explain diverse observations . Validation experiments specifically designed to test hypotheses that could reconcile contradictory findings should be conducted, such as examining whether post-translational modifications or RNA editing events differ between experimental systems, potentially explaining functional variations . Additionally, computational modeling approaches can integrate diverse experimental data into mechanistic frameworks that predict how different experimental conditions might lead to distinct functional outcomes, thereby providing theoretical explanations for observed contradictions . This comprehensive approach to data interpretation transforms apparent contradictions into opportunities for deeper mechanistic understanding of ATP synthase protein MI25 function across different biological contexts.

What are the current limitations in computational modeling of ATP synthase MI25 structure and function, and how might these be addressed?

Current computational modeling of ATP synthase MI25 structure and function faces several key limitations that require innovative solutions to advance our understanding of this complex protein. One significant challenge is the accurate prediction of transmembrane domain structures and their interactions with membrane lipids, which is critical for understanding MI25 function but remains difficult with current algorithms that often inadequately model the unique physicochemical environment of the membrane-protein interface . The dynamic nature of ATP synthase conformational changes during catalysis presents another limitation, as most modeling approaches provide static representations rather than capturing the continuous conformational landscape that characterizes functional protein dynamics, limiting our understanding of how MI25 participates in the rotational catalysis mechanism . Current models also struggle to accurately incorporate the effects of post-translational modifications and RNA editing events, such as the polar edits observed in ATP synthase subunits that significantly impact function, due to limitations in force fields and scoring functions that inadequately represent these chemical alterations . Additionally, modeling protein-protein interactions within the multi-subunit ATP synthase complex remains challenging due to the size and complexity of the assembly, often requiring simplifications that may not capture the full range of cooperative interactions that determine complex stability and function . To address these limitations, researchers can implement several strategies: developing specialized force fields optimized for membrane proteins, employing enhanced sampling techniques to capture conformational dynamics, integrating experimental data (such as crosslinking constraints or cryo-EM densities) to guide modeling, and utilizing multi-scale modeling approaches that bridge atomic-level details with larger-scale complex dynamics . These advancements would significantly improve our ability to model ATP synthase MI25 structure and function, providing deeper insights into its role in plant energy metabolism.

Table 1: Comparative Analysis of Key Features Between Zea mays ATP Synthase Protein MI25 and Related Proteins in Other Plant Species

FeatureZea mays ATP Synthase Protein MI25Arabidopsis ATP Synthase Subunits (OSCP/γ)Withania somnifera ATP Synthase b Subunit
Protein Size219 amino acids Variable (subunit-dependent) Variable (function of RNA editing)
Key Structural ElementsTransmembrane regions, cytoplasmic domains α-helical structures, binding domains for other subunits α-helical structure (residues 12-26), transmembrane α-helix (33-47)
Post-translational ModificationsNot fully characterized in available dataPhosphorylation sites identified RNA editing sites (S20F, S24L, S30L, S72L, P76L, etc.)
Functional Impact of Reduced ExpressionNot directly characterized in available dataSeedling lethality, stunted growth, morphological abnormalities Not directly characterized in available data
Effect on ATP LevelsNot directly characterized in available dataCondition-dependent: decreased in dark without sucrose, increased in light or with sucrose RNA editing affects ATPase activity
Associated Cellular ProcessesATP synthesis, cellular respiration Cellular redox state regulation, transcription factor expression Proton translocation, complex stabilization
Response to Environmental StressNot directly characterized in available dataAltered expression of stress-related genes RNA editing patterns may respond to salt stress
Structural AdaptationsNot directly characterized in available dataNot directly characterized in available dataPolar edits enhance H+ selectivity and introduce stabilizing coiled-coil structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.