Recombinant Zea mays ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag requirement, please communicate it to us, and we will prioritize development according to your specifications.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
atpI
Target Protein Sequence
MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural role of atpI in Zea mays chloroplast ATP synthase?

The atpI subunit in chloroplast ATP synthase functions primarily as a membrane protein involved in the assembly and stability of the ATP synthase complex. While not directly involved in the catalytic activity, atpI plays a critical role in maintaining the structural integrity of the enzyme complex, particularly in the assembly of the c-ring oligomer. Studies in bacterial systems have shown that deletion of atpI leads to reduced stability of the ATP synthase rotor and decreased membrane association of the F₁ domain . In Zea mays chloroplasts, the atpI subunit likely performs similar structural functions, facilitating the proper assembly of the ATP synthase complex necessary for efficient ATP synthesis during photosynthesis.

Methodologically, the structural role can be investigated through site-directed mutagenesis of key residues followed by analysis of complex stability using blue native gel electrophoresis, electron microscopy, or FRET-based approaches to monitor subunit interactions within the assembled complex.

How does recombinant expression of Zea mays atpI differ from native expression?

Recombinant expression of Zea mays atpI often yields proteins with structural properties similar to the native form, but with important differences in post-translational modifications and protein folding efficiency. When expressing chloroplastic atpI in heterologous systems such as E. coli, researchers must account for the absence of chloroplast-specific chaperones and folding machinery.

For optimal expression, researchers should consider:

  • Codon optimization for the expression host

  • Addition of chloroplast transit peptides if studying targeting mechanisms

  • Expression temperature optimization (typically lower temperatures of 18-25°C)

  • Use of specialized E. coli strains capable of forming disulfide bonds when necessary

In contrast to native expression, recombinant systems allow for controlled incorporation of tags for purification and detection, as well as the introduction of site-specific mutations to study structure-function relationships .

What purification methods are most effective for recombinant Zea mays atpI?

The purification of recombinant Zea mays atpI presents challenges due to its hydrophobic nature as a membrane protein. Based on established protocols for similar ATP synthase subunits, the following multi-step approach is recommended:

  • Membrane fractionation: Differential centrifugation to isolate membrane fractions containing the expressed atpI

  • Detergent solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at 0.5-1% concentration

  • Affinity chromatography: Using engineered His-tags or other affinity tags

  • Size exclusion chromatography: For final polishing and buffer exchange

This approach has been successfully used for purification of ATP synthase components with yields of approximately 0.7-1 mg/L of culture . Purification should be performed at 4°C to minimize protein degradation, and the addition of protease inhibitors is strongly recommended throughout the process.

What expression systems are most suitable for producing functional recombinant Zea mays atpI?

For functional studies of recombinant Zea mays atpI, several expression systems can be considered, each with specific advantages:

Expression SystemAdvantagesChallengesTypical Yield
E. coliRapid growth, easy genetic manipulationLimited post-translational modifications, inclusion body formation0.5-2 mg/L
Yeast (P. pastoris)Eukaryotic folding machinery, higher yieldLonger expression time, glycosylation differences2-5 mg/L
Plant-based systemsNative-like processing, correct foldingLower yield, longer growth time0.1-0.5 mg/L
Cell-free systemsMembrane protein-friendly, rapidExpensive, limited scale0.1-0.3 mg/mL reaction

How does redox regulation affect Zea mays chloroplastic atpI function and interaction with other ATP synthase subunits?

Redox regulation represents a critical control mechanism for chloroplast ATP synthase activity. While the γ subunit contains a well-characterized redox switch that modulates enzyme activity to limit ATP hydrolysis at night , the interaction between this regulation and atpI function remains less understood.

Research evidence suggests that oxidation-reduction events may influence subunit interactions within the ATP synthase complex. In spinach chloroplast ATP synthase, a disulfide linkage in the oxidized γ subunit introduces torsional constraints that stabilize β hairpin structures. Upon reduction, these constraints are alleviated, resulting in concerted motion of the enzyme complex and facilitating smooth transition between rotary states for ATP synthesis .

Methodologically, researchers can investigate redox effects on atpI using:

  • Site-directed mutagenesis of cysteine residues

  • Differential labeling of thiols under oxidizing/reducing conditions

  • Cryo-EM structural studies under various redox states

  • Cross-linking experiments to identify redox-dependent interaction partners

These approaches can help elucidate how redox changes propagate through the ATP synthase complex and potentially influence atpI function in maintaining structural integrity or participating in regulatory mechanisms.

What role does atpI play in the assembly pathway of Zea mays chloroplast ATP synthase?

The assembly of chloroplast ATP synthase involves a coordinated process of subunit synthesis, membrane insertion, and complex formation. Based on studies in bacterial systems, atpI appears to function as a chaperone specifically involved in c-ring oligomer formation during ATP synthase assembly .

In Zea mays, the assembly pathway likely follows a sequential process where:

  • Individual subunits are synthesized in the cytosol and imported into chloroplasts

  • AtpI facilitates the assembly of the c-ring within the thylakoid membrane

  • The c-ring associates with other Fo components (subunits a and b)

  • The F1 portion docks onto the assembled Fo complex

Researchers can investigate the assembly role of atpI through pulse-chase experiments, assembly intermediate characterization, and interaction studies with other ATP synthase components and potential assembly factors.

How do post-translational modifications affect the function of Zea mays chloroplastic atpI?

Post-translational modifications (PTMs) of chloroplast proteins play significant roles in regulating their function, localization, and interactions. For Zea mays chloroplastic atpI, potential PTMs include:

  • Phosphorylation: May regulate assembly or interaction with other subunits

  • Acetylation: Could influence protein stability or membrane association

  • Oxidative modifications: May affect function under stress conditions

  • Proteolytic processing: Transit peptide cleavage upon chloroplast import

To study PTMs of atpI, researchers should employ:

  • Mass spectrometry-based proteomics to identify modification sites

  • Phospho-specific antibodies for western blotting

  • Mutagenesis of modified residues to alanine or mimicking residues (e.g., glutamate for phosphoserine)

  • In vitro modification assays with purified kinases or other modifying enzymes

Understanding the PTM landscape of atpI will provide insights into how its function is fine-tuned in response to developmental and environmental cues in Zea mays chloroplasts.

How does the interaction between atpI and c-ring subunits affect proton translocation in Zea mays chloroplast ATP synthase?

The interaction between atpI (subunit a) and the c-ring is critical for proton translocation across the thylakoid membrane and subsequent ATP synthesis. Studies in bacterial systems have shown that deletion of atpI leads to more than a 50% reduction in ATP-driven proton-pumping activity compared to wild-type .

In the chloroplast ATP synthase mechanism:

  • Protons from the thylakoid lumen enter through a half-channel in subunit a

  • Protons bind to a conserved carboxylate in c-subunits

  • The protonation causes rotation of the c-ring

  • Protons are released into the stroma through another half-channel in subunit a

  • The rotation of the c-ring drives conformational changes in the F1 domain, leading to ATP synthesis

The specific interactions between atpI and the c-ring that facilitate this process can be investigated through:

  • Site-directed mutagenesis of residues at the atpI/c-ring interface

  • Proton pumping assays using reconstituted proteoliposomes

  • Structure determination by cryo-EM under different conformational states

  • Molecular dynamics simulations to model proton transfer pathways

These approaches would help elucidate the molecular details of how atpI contributes to the proton translocation mechanism in Zea mays chloroplast ATP synthase.

What experimental approaches can accurately measure the impact of atpI mutations on ATP synthase assembly and function?

Assessing the impact of atpI mutations requires a multi-faceted approach targeting different aspects of ATP synthase assembly and function:

  • Assembly assessment:

    • Blue native PAGE to visualize intact complexes and assembly intermediates

    • Sucrose gradient centrifugation to separate complexes by size

    • Immunoprecipitation to identify interaction partners

    • Quantification of membrane-associated vs. soluble F1 components by western blotting

  • Functional assays:

    • ATP hydrolysis activity measurements with and without detergents like octyl-glucoside

    • ATP synthesis assays using reconstituted proteoliposomes with artificially imposed proton gradients

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Rotation assays for single-molecule studies of ATP synthase mechanics

  • Structural stability analysis:

    • Thermal shift assays to assess complex stability

    • Limited proteolysis to identify exposed or flexible regions

    • Analysis of c-ring stability under different detergent/denaturant conditions

These methodologies, when applied systematically to wild-type and mutant atpI variants, can provide comprehensive insights into how specific residues or domains contribute to assembly and function.

How can researchers effectively reconstitute recombinant Zea mays atpI into functional ATP synthase complexes?

Reconstitution of functional ATP synthase complexes containing recombinant Zea mays atpI requires careful consideration of lipids, detergents, and assembly conditions:

  • Preparation of liposomes:

    • Use chloroplast-mimetic lipid compositions (MGDG, DGDG, SQDG, and PG)

    • Control lipid-to-protein ratios (typically 50:1 to 100:1 w/w)

    • Prepare unilamellar vesicles by extrusion through polycarbonate filters

  • Detergent-mediated reconstitution:

    • Solubilize purified atpI and other ATP synthase components in mild detergents

    • Mix with preformed liposomes

    • Remove detergent by dialysis or absorption to Bio-Beads

  • Verification of reconstitution:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Sucrose flotation to separate proteoliposomes from unincorporated protein

    • Functional assays to confirm ATP synthesis capability

  • Measurement of ATP synthesis:

    • Generate artificial proton gradients using valinomycin-induced K+ diffusion potentials

    • Measure ATP production using luciferase-based assays

    • Quantify ATP synthesis rates under different driving force conditions

This reconstitution approach has been successfully used with bacterial ATP synthases, achieving ATP synthesis rates of approximately 100 nmol·min⁻¹·mg protein⁻¹ , and can be adapted for chloroplast ATP synthase components.

What computational approaches can predict the structural features and interactions of Zea mays atpI?

Computational approaches offer valuable insights into atpI structure and interactions when experimental structural data is limited:

  • Homology modeling:

    • Use bacterial or other plant ATP synthase subunit a structures as templates

    • Refine models with molecular dynamics simulations

    • Validate models through comparison with biochemical data

  • Molecular dynamics simulations:

    • Embed modeled atpI in lipid bilayers mimicking thylakoid membrane composition

    • Simulate protein behavior in different protonation states

    • Identify stable conformational states and potential proton pathways

  • Protein-protein docking:

    • Predict interactions between atpI and other ATP synthase subunits, particularly c-ring

    • Calculate binding energies and interface contacts

    • Identify key residues for mutagenesis studies

  • Evolutionary coupling analysis:

    • Identify co-evolving residue pairs that may be functionally important

    • Map conservation patterns onto structural models

    • Predict functional domains based on sequence conservation

These computational approaches can generate testable hypotheses about atpI function and guide experimental design, particularly for site-directed mutagenesis and interaction studies.

What are the emerging techniques that could advance our understanding of Zea mays chloroplastic atpI?

Several cutting-edge technologies show promise for deepening our understanding of atpI structure, function, and interactions:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of ATP synthase in different conformational states

    • Has revolutionized our understanding of chloroplast ATP synthase structure

    • Can reveal redox-dependent structural changes at near-atomic resolution

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes

    • Rotation assays to directly observe c-ring movement

    • Force measurements to quantify mechanical properties

  • Mass spectrometry innovations:

    • Hydrogen-deuterium exchange for mapping protein dynamics

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Native mass spectrometry for intact complex analysis

  • CRISPR-based approaches:

    • Precise genome editing in Zea mays to study atpI mutations in vivo

    • Base editing for introducing specific amino acid changes

    • CRISPRi for conditional downregulation of atpI expression

These emerging technologies will enable researchers to address unresolved questions about atpI function in chloroplast ATP synthase and potentially reveal novel regulatory mechanisms specific to Zea mays.

How might research on Zea mays atpI contribute to broader understanding of chloroplast energetics and plant adaptation?

Research on Zea mays atpI extends beyond basic understanding of ATP synthase function to broader implications for plant physiology and adaptation:

  • Energy regulation mechanisms:

    • Insights into how C4 plants like Zea mays regulate ATP production

    • Understanding of chloroplast energetic demands during high photosynthetic activity

    • Potential differences in regulation compared to C3 plants

  • Stress adaptation responses:

    • Role of atpI in maintaining ATP synthase function under temperature extremes

    • Adaptation mechanisms during drought or high light conditions

    • Potential for engineering improved stress tolerance

  • Evolutionary perspectives:

    • Comparison with bacterial atpI homologs to understand evolutionary conservation

    • Divergence patterns specific to C4 photosynthesis adaptation

    • Co-evolution with other ATP synthase components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.