Recombinant Zea mays CASP-like protein 1

Shipped with Ice Packs
In Stock

Description

Functional Roles in Casparian Strip Formation and Stress Adaptation

CASPs and CASPLs are essential for Casparian strip (CS) formation, a specialized structure in root endodermal cells that regulates ion transport and apoplastic barrier integrity . While ZmCASPL1 is not explicitly studied, related proteins exhibit:

  • Root-specific expression: ZmCASPL21 and ZmCASPL47 show high root-specific expression, suggesting roles in CS development or stress responses .

  • MYB-binding sites: 72% of ZmCASPL genes contain MYB-binding motifs (e.g., CAACCA), linking them to MYB36-mediated regulation of CS-related genes .

Recombinant Constructs and Experimental Approaches

Recombinant ZmCASPL proteins are typically produced using:

  • In-Fusion cloning: Used in rice OsCASP1 studies for promoter-GUS fusion constructs .

  • CRISPR/Cas9: Employed to generate knockout mutants (e.g., ZmSTL1 mutants show defective CS lignin deposition) .

Construct TypeCloning MethodApplication
Promoter-Gene FusionsIn-Fusion (Hind III/Xcm I)Tissue-specific expression analysis
CRISPR KnockoutsCas9/gRNA systemsFunctional genomics

Methods inferred from rice and maize studies .

Comparative Analysis with Rice and Arabidopsis CASPs

While ZmCASPL1 is distinct, its functional analogs include:

  • OsCASP1 (Rice): Regulates CS formation and suberin deposition under salt stress; loss-of-function mutants show delayed CS development .

  • AtCASPs (Arabidopsis): Scaffold lignin polymerization machinery via extracellular loops; CIF1/2-SGN3-SGN1 complex ensures CS continuity .

SpeciesProteinKey FunctionStress Response
Zea maysZmCASPL21Root-specific CS developmentSalt tolerance
OryzaOsCASP1CS formation, suberin depositionSalt-induced ion imbalance
ArabidopsisAtCASP1CS scaffold for lignin polymerizationApoplastic barrier integrity

Challenges and Future Directions

  • Nomenclature ambiguity: The term "ZmCASPL1" is not explicitly defined in maize literature; studies refer to family members like ZmCASPL21/47 .

  • Functional gaps: Direct characterization of ZmCASPL1's role in CS formation or stress responses remains unreported.

  • Recombinant applications: Prioritizing CRISPR-based mutagenesis and tissue-specific expression profiling to elucidate ZmCASPL1's function.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to fulfill specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on your purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Casparian strip membrane protein 2; ZmCASP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MSTSDAAATVIPIDDVPRQHGKAPAVDTVTAAPPPLAAAAPPAATTAPRKTRVPFFRRAD RGSRCVALLDLVLRVAAFGPALAAAIATGTSDETLSVFTQFFQFHARFDDFPALLFFMVA NAIAAGYLVLSLPFSAVVVLRPQAIGLRHLLLICDLIIAALLTAAAAAAAAIVDLAHSGN QRANWVPICMQFHGFCQRTSGAVVASFLAVLVLLFLVILAAFTIRKRC
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. Casparian strips are cell wall modifications in the root endodermis, creating an apoplastic barrier between the internal and external apoplasm. This barrier prevents lateral diffusion.
Database Links

KEGG: zma:100285037

UniGene: Zm.161912

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZmCASPL1 and how does it relate to other CASP family proteins?

ZmCASPL1 is a member of the CASP-like protein family in maize (Zea mays), related to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs) first characterized in Arabidopsis. CASPs are four-membrane-span proteins that function as scaffolds to mediate the deposition of Casparian strips in the endodermis by recruiting lignin polymerization machinery . The CASP-like (CASPL) protein family is found throughout land plants and green algae, with homologs outside the plant kingdom identified as members of the MARVEL protein family .

CASP proteins show remarkable stability in their membrane domains and present characteristics of a membrane scaffold. When expressed in the endodermis, most CASPLs can integrate into the CASP membrane domain, suggesting they share the ability to form transmembrane scaffolds . In rice, OsCASP1 shows high sequence similarity to Arabidopsis CASPs and plays key roles in Casparian strip formation .

What are the characteristic structural features of CASP and CASP-like proteins?

CASP and CASP-like proteins share a conserved structure with four transmembrane domains. Key structural features include:

  • Four transmembrane spans with conserved residues, particularly in TM1 and TM3

  • Variable extracellular loops (EL1 and EL2) with different degrees of conservation

  • A signature nine-amino acid sequence (ESLPFFTQF) in the first extracellular loop (EL1) of CASP proteins in seed plants with Casparian strips

  • Conserved basic (Arg, His, and Lys) and acidic (Asp and Glu) amino acids in TM1 and TM3, similar to MARVEL proteins

Experimental evidence shows that the transmembrane domains are critical for proper localization, while the extracellular loops contribute to but are not essential for localization. When the entire EL2 (Δ158:175) was deleted in AtCASP1, the protein could still localize to the Casparian strip domain (CSD), although its signal faded faster than wild type . Similarly, deletions in EL1 did not prevent localization but affected the timing and stability of the protein at the CSD .

How is ZmCASPL1 expression regulated in different tissues and environmental conditions?

While the search results don't specifically mention ZmCASPL1 expression patterns, we can draw parallels from studies on rice OsCASP1, which is:

  • Highly expressed at small lateral root tips (SLRs)

  • Strongly expressed in root tissues, especially in the stele and sclerenchyma after salt treatment

  • Upregulated in response to salt stress in both roots and leaves

  • Differentially expressed across developmental stages, with higher expression in SLRs and younger roots, moderate expression in primary root tips, and weaker expression in leaves

Expression analysis using GUS reporter constructs has been valuable for determining the tissue-specific expression patterns of CASP proteins. For example, in rice, the OsCASP1 promoter driving OsCASP1-GUS showed intense activity at SLR tips and in stele tissues . Similar approaches would be applicable for studying ZmCASPL1 expression.

What phenotypes are associated with CASPL mutations in crops?

Mutations in CASP genes result in distinctive phenotypes related to barrier function disruption. In rice, the loss of OsCASP1 function leads to:

  • Withered leaf phenotype

  • Fewer tillers compared to wild type plants

  • Delayed Casparian strip formation in small lateral roots

  • Ectopic suberin deposition in roots

  • Altered ion balance within plant tissues

These phenotypes demonstrate the importance of CASP proteins in maintaining proper plant water relations and nutrient homeostasis. The withered leaf phenotype and reduced tillering in rice Oscasp1 mutants suggest systemic effects of compromised root barrier function.

In maize, ZmSTL1 (which encodes a dirigent protein called ZmESBL) confers natural variation in Casparian strip formation and is associated with salt tolerance . While this is not a CASP protein itself, it works within the same biological pathway as CASPs to regulate Casparian strip formation.

What are the most effective methods for recombinant expression and purification of ZmCASPL1?

While the search results don't provide specific protocols for ZmCASPL1 expression and purification, effective strategies can be inferred from related research on membrane proteins:

Expression Systems:

  • Bacterial expression (E. coli): May be challenging due to the membrane-spanning nature of CASP proteins but could be optimized using specialized strains designed for membrane protein expression

  • Yeast expression (P. pastoris or S. cerevisiae): Often more suitable for eukaryotic membrane proteins

  • Plant-based expression: N. benthamiana transient expression system has been successfully used for DDRM1 protein studies and could be adapted for ZmCASPL1

Purification Approaches:

  • Affinity tags: His, GST, or MBP tags as demonstrated for SOG1 (MBP-SOG1) and DDRM1 (GST-DDRM1) proteins

  • Detergent selection: Critical for maintaining protein stability and function during extraction from membranes

  • Size exclusion chromatography: For final purification and assessment of protein oligomeric state

Important considerations include maintaining the native confirmation of the transmembrane domains and optimizing buffer conditions to prevent aggregation while ensuring proper folding.

What techniques are available for studying ZmCASPL1 localization and dynamics in planta?

Several complementary approaches can be employed to study ZmCASPL1 localization and dynamics:

Fluorescent Protein Fusions:

  • C-terminal or N-terminal GFP/mCherry fusions expressed under native promoters

  • CASP1-mCherry fusions have been successfully used in Arabidopsis to study localization to the Casparian strip domain

Tissue Clearing and Imaging:

  • ClearSee solution treatment followed by staining with Basic Fuchsin and Calcofluor White has been effective for visualizing Casparian strips in rice roots

  • This approach allows whole-mount observation of small lateral roots to obtain clear Casparian strip structure visualization

Promoter-Reporter Constructs:

  • GUS reporter assays under native promoter control can reveal tissue-specific expression patterns

  • The OsCASP1pro:OsCASP1-GUS construct successfully demonstrated expression patterns in rice

For dynamic studies, photoactivatable or photoconvertible fluorescent proteins could be employed to track protein movement and turnover rates within membrane domains.

How can protein-protein interactions of ZmCASPL1 be investigated?

Several complementary approaches can be used to study ZmCASPL1 interactions:

Co-immunoprecipitation (CoIP):

  • Expression of tagged versions (e.g., FLAG, GFP) in heterologous systems like N. benthamiana or in stable transgenic plants

  • Protein extraction followed by immunoprecipitation with tag-specific antibodies

  • Western blotting to detect interacting partners

In vitro Pull-down Assays:

  • Production of recombinant proteins with different tags (e.g., GST, MBP)

  • Incubation of purified proteins followed by affinity purification

  • This approach has been successful for demonstrating direct interaction between DDRM1 and SOG1 proteins

Yeast Two-Hybrid or Split-Ubiquitin Assays:

  • Particularly useful for membrane proteins like ZmCASPL1

  • Modified membrane-based yeast two-hybrid systems can overcome limitations of traditional Y2H for membrane proteins

Bimolecular Fluorescence Complementation (BiFC):

  • In planta visualization of protein-protein interactions

  • Especially valuable for confirming interactions in their native cellular context

When designing these experiments, it's important to consider that modifications of the protein (such as mutations in functional domains) may affect interaction capabilities while preserving basic structure, as demonstrated with DDRM1m1 .

What approaches are most effective for functional characterization of ZmCASPL1 mutants?

Functional characterization of ZmCASPL1 mutants should employ multiple approaches:

Generation of Mutant Lines:

  • CRISPR/Cas9 gene editing: Has been successfully used to generate Oscasp1-4 mutants in rice

  • T-DNA insertion or EMS mutagenesis: Alternative approaches for generating loss-of-function mutants

  • Natural variation identification: Screening diverse germplasm for natural mutations, as demonstrated with Oscasp1-3, a natural mutant identified in a paddy field

Phenotypic Analyses:

  • Barrier function assessment: Evaluation of Casparian strip integrity using histochemical staining and permeability assays

  • Salt stress response: Measuring growth parameters, ion content, and physiological responses under salt stress conditions

  • Root development analysis: Quantification of root architecture changes, particularly in lateral roots

Molecular Analyses:

  • Transcriptome profiling: RNA-seq to identify downstream genes affected by ZmCASPL1 mutation

  • Metabolome analysis: Profiling changes in metabolites related to stress responses

  • Protein localization studies: Examining localization of other barrier-related proteins in mutant backgrounds

Complementation Studies:

  • Transformation with wild-type ZmCASPL1 to verify mutant phenotype causality

  • Domain swapping or site-directed mutagenesis to identify critical functional regions

For example, in rice, the complementation of Oscasp1-3 was achieved by transforming the OsCASP1pro:OsCASP1 construct into mutant calli, demonstrating that the mutant phenotype was indeed caused by the loss of OsCASP1 function .

How does the localization mechanism of ZmCASPL1 compare to that of Arabidopsis CASPs?

Based on knowledge of Arabidopsis CASPs and rice OsCASP1:

Shared Localization Mechanisms:

  • Both Arabidopsis CASPs and rice OsCASP1 localize to the Casparian strip domain (CSD) in the endodermis

  • The transmembrane domains are critical for proper localization in both species

  • Extracellular loops contribute to but are not essential for CSD localization

Species-Specific Differences:

  • Timing of Casparian strip formation differs between rice and Arabidopsis, with rice forming Casparian strips earlier in development

  • Rice Casparian strips appear to have different properties regarding permeability to propidium iodide (PI) compared to Arabidopsis

Structural Requirements:

  • In Arabidopsis CASP1, deletion of entire extracellular loops (EL1 or EL2) did not prevent localization to the CSD, although timing and stability were affected

  • The conserved Asp residue in TM3 appears essential for proper protein folding in Arabidopsis CASP1

Understanding these similarities and differences can provide insights into the conservation and divergence of CASP function across species and help predict the behavior of ZmCASPL1.

What is the relationship between ZmCASPL1 and abiotic stress responses, particularly salt tolerance?

While the search results don't directly address ZmCASPL1's role in stress responses, insights can be drawn from studies on related proteins:

Salt Stress Regulation:

  • In rice, OsCASP1 expression is strongly induced by salt stress in roots and leaves

  • OsCASP1 is particularly upregulated in the stele and sclerenchyma cells after NaCl treatment

Physiological Mechanisms:

  • CASP proteins influence Casparian strip formation, which controls ion movement between soil solution and plant vascular system

  • Loss of OsCASP1 function leads to altered ion balance in plants, suggesting a direct link between CASP function and ion homeostasis

  • In maize, ZmSTL1 (encoding ZmESBL) confers natural variation in Casparian strip development and is associated with salt tolerance

Research Approaches:

  • Gene expression analysis under various salt stress conditions and timepoints

  • Ion content measurement in different tissues of wild-type and mutant plants

  • Water transport and hydraulic conductivity assessments

  • Root pressure measurements to evaluate the barrier function

Researchers investigating ZmCASPL1's role in stress responses should consider both short-term and long-term stress treatments, as the protein may be involved in both immediate responses and adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.